SecReT6
Protein ID: 291617919
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2366
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2636881..2637423 [-]
Producthypothetical Protein
NoteTssB
UniProt IDD4GHL6
KEGG IDpam:PANA_2366
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-60, Aligned region: 16..168
Protein Sequence: 180 a.a.     [Download]
>gi|291617919|ref|YP_003520661.1| hypothetical Protein PANA_2366 [Pantoea ananatis LMG 20103]
MERTMPTMKSSGQKFIARNRAPRVQIEYDVEVYGAERKIQLPFIMGVLADLAGKPLEPQASVDDRKFMEI
DIDNFDERMKAMKPRAAFQVDNTLNGDGKLNIDLTFESMDDFSPDAIARKVDPLNSLLEARTQLSNLLTY
MDGKNGAEELIGKILQDPTLLQALSHVPKQTDAPEGKEEQ
 
Nucleotide Sequence: 543 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2637423-2636881 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGAGAGAACCATGCCAACAATGAAGTCCAGTGGGCAGAAATTTATCGCCCGCAATCGCGCGCCACGCG
TTCAGATTGAATATGACGTGGAAGTCTATGGCGCAGAACGTAAAATTCAGCTGCCATTCATCATGGGTGT
TCTGGCCGATTTAGCCGGTAAACCGCTGGAGCCGCAGGCCAGCGTTGACGACCGTAAATTCATGGAAATC
GACATCGACAATTTCGATGAGCGTATGAAAGCCATGAAGCCACGTGCGGCATTCCAGGTAGACAATACGT
TGAACGGTGACGGCAAACTGAACATCGATCTGACCTTCGAAAGCATGGACGATTTTTCTCCTGATGCCAT
TGCACGCAAAGTCGATCCACTCAACAGCCTGCTTGAAGCACGTACCCAGCTCTCCAACCTGCTGACCTAT
ATGGACGGCAAAAACGGCGCCGAAGAGCTGATCGGCAAGATTTTACAGGATCCGACACTGCTGCAGGCCC
TGTCACACGTGCCTAAGCAAACGGATGCCCCTGAAGGTAAGGAGGAGCAGTAA
 Primer design