SecReT6
Protein ID: 291617920
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2367
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2637492..2638589 [-]
Producthypothetical Protein
NoteTssA
UniProt IDD4GHL7
KEGG IDpam:PANA_2367
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 79..138
Protein Sequence: 365 a.a.     [Download]
>gi|291617920|ref|YP_003520662.1| hypothetical Protein PANA_2367 [Pantoea ananatis LMG 20103]
MIRQAVQSRDETDFIPRCLNPEAKRMSIDIDTLLIPVSHDNPCGENLEYDADFQAMEQASVGKAEQQFGN
TIIPAEPADWNKVEKLALELMSRSKDLRVMLTLTHAWTRLKGLPGYAQGLQLIEQAMLQFWEPLWPRLEE
DGEHDPFYRINALAVLGDQSALTAAVRQSWLMRYASDGITLRDASALCDGSKTEVPDYPGGLPRLNDELA
RGEQPGIAAIQNIAERLQNIRRIVIEKLDETALPDMSQLQRSMAMLNERCQATDMESLHSLAAAMQSAPA
TEQQPSVAAPRAATDWRSAQLNSRAEAQLMLEKVKQYFSQHEPSHPAPLMIDRVQRLIELDFMDIIRDLA
PDGVHQLENIFGRRD
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2638589-2637492 Pantoea ananatis LMG 20103 chromosome, complete genome
TTGATCCGGCAGGCGGTGCAAAGCCGGGACGAAACGGACTTTATCCCCCGATGTTTGAATCCTGAGGCGA
AGCGGATGAGTATTGATATTGACACGTTGCTGATACCGGTAAGCCATGATAATCCGTGCGGTGAAAACCT
GGAGTACGACGCGGACTTTCAGGCGATGGAGCAGGCCAGCGTGGGAAAAGCCGAACAGCAGTTCGGTAAC
ACCATTATTCCGGCTGAGCCAGCGGACTGGAACAAAGTTGAAAAGCTTGCACTGGAACTGATGAGCCGCA
GCAAAGACCTGCGTGTCATGCTGACCCTGACACATGCCTGGACGCGCCTGAAAGGGTTACCGGGCTATGC
ACAGGGCCTGCAACTGATTGAACAGGCGATGTTGCAGTTCTGGGAACCGCTCTGGCCTCGCCTTGAAGAA
GATGGCGAGCACGATCCGTTTTACCGCATCAACGCGCTGGCTGTGCTGGGCGATCAGTCGGCACTTACGG
CCGCCGTTCGTCAGTCATGGCTCATGCGCTATGCGTCCGATGGTATTACGCTGCGTGATGCTTCGGCGCT
GTGTGACGGCAGTAAAACAGAGGTGCCAGATTATCCGGGTGGGCTGCCGCGTCTGAATGACGAACTTGCA
CGAGGGGAACAACCGGGCATCGCAGCGATTCAAAACATTGCTGAGCGTTTGCAAAATATTCGCCGCATCG
TGATTGAAAAGCTGGATGAAACGGCCTTGCCGGATATGAGTCAGCTGCAACGCAGCATGGCAATGCTGAA
TGAGCGCTGTCAGGCCACGGATATGGAATCGTTACACTCCCTGGCGGCGGCGATGCAATCCGCACCCGCA
ACGGAGCAGCAGCCCAGCGTCGCTGCACCACGTGCGGCTACCGACTGGCGCAGTGCCCAACTGAATTCGC
GGGCAGAAGCCCAACTTATGCTGGAAAAGGTCAAACAGTACTTTAGTCAGCATGAGCCGAGCCACCCGGC
ACCGCTGATGATTGACAGGGTACAGCGCCTTATCGAACTCGATTTTATGGACATCATTCGCGATCTCGCG
CCCGATGGTGTGCATCAGTTAGAAAACATTTTTGGACGCCGCGACTAA
 Primer design