SecReT6
Protein ID: 291617922
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2369
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2639253..2642879 [-]
Producthypothetical Protein
NoteTssM
UniProt IDD4GHL9
KEGG IDpam:PANA_2369
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.80E-98, Aligned region: 208..486
IcmF-related [PF06761], Evalue: 1.00E-85, Aligned region: 535..841
DUF1215 [PF06744], Evalue: 7.70E-31, Aligned region: 861..888
DUF1215 [PF06744], Evalue: 7.70E-31, Aligned region: 950..1075
Xpo1 [PF08389], Evalue: 0.0092, Aligned region: 578..603
Xpo1 [PF08389], Evalue: 0.0092, Aligned region: 633..665
Xpo1 [PF08389], Evalue: 0.0092, Aligned region: 779..822
Protein Sequence: 1208 a.a.     [Download]
>gi|291617922|ref|YP_003520664.1| hypothetical Protein PANA_2369 [Pantoea ananatis LMG 20103]
MLNVLFAVLTSRLAWGFVGITALSFIIWVIGPVFSIVDSRPLESEQNRVISIALLYVVWGLSQAIPRVYN
YWLNRKLMSSLETSKSDTPEEDRKRLTSEDQVLASRFSEATEMLKKAHFQRQSSKGAPFWAQRFSHQYLY
QLPWYMIIGAPGAGKTTALVNSGLQFPLADKFGKAALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQ
ERDAGEWHQFLDLLRKYRGRQPVNGVIVTLSVADLLSQSPEAMRNQAVALRQRLMELHDRLGIRFPVYVL
VTKTDLLKGFRSYFASLDKAQREQIWGFTFPWAKASTAEFELSSQFQQEYSLLQQRLDAGLADVLLAESD
AQARAESYLFPQEFAALRPQLAEALDILFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELTRALHLPG
QQQSESGSWDKVDKDAPIPQNKGQSFFLKGVLENVIFQESGLAGSNRWWELRNRVGLWSGYLALLVIVLI
AGALWLVSYNKNKTYLQEMAAKSPQVEQLGDKLQKEVNGNLFALVPYLNTLLHLPESASFSLEHPPLTRR
MGLYRGTEVSDATQALYERALKQLLMPQVAQNITRWLRNDTGSDADYSYEALKAYQMLYQPKHYDGKFLQ
AWMMLNISRELPQDVTQAEVKQLAWHLQQLLETQIQSSPYAKDDALVKREQALISQMPLSQRVYGRLKRL
LERDGSMSPVTLSALGGPQSELVFSRKSGKSVNEGVSGLFTPDGYWNHVDKQIAPVTDALYKDDIWVLGA
ETAHEDSKQTDLAVRQLYIQDYIRQWEQFLSDIQLNSSADLTQRINTARLLSGNHSPLRQLVINLSKQLT
LTRAQPEDKNAKDTAASSDNSATRTLQALFTSPRANGEQAVVQQTPEQAVTAHFAPVIELAQPLQQGSKV
LAVDDFLKQIDDLYRYLTAVQDAANSGMPPPASDAISRLQASAGRLPGSLQNMVSGMAVGASSDAQRRDM
DNVRKRITMEVGSFCRQAIAGRYPLVRNARSEVTPDDLARMFAPGTGLMDSFFRDNLASKVDTTRAAWRF
TPGIDGKTLPGGEALLRPFQQAQSIRDAFFANGATTPSFRVTLRTVKMDNDILNMTLDVDGQILRYSHGP
QAVQLVSWPGPGGTSQVRMQLGLTNGTTSTLTTSGPWALNRFFDRARVTSVGGLTREASFSVDGHNVTLS
FTPGSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2642879-2639253 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGCTGAATGTACTATTTGCGGTACTGACCAGCCGTCTGGCCTGGGGCTTTGTCGGTATCACCGCACTTT
CGTTTATTATCTGGGTCATTGGCCCGGTGTTCTCGATTGTGGACTCCCGTCCGTTGGAGTCAGAACAGAA
CCGCGTAATCAGTATTGCGTTGCTCTATGTTGTCTGGGGCCTGAGCCAGGCGATTCCGCGTGTCTATAAC
TACTGGCTCAACCGTAAGCTGATGTCCAGCCTGGAAACCAGCAAATCGGATACGCCGGAAGAAGACCGCA
AGCGACTGACCAGTGAAGATCAGGTGCTGGCCAGCCGCTTCTCCGAAGCGACTGAGATGCTGAAAAAAGC
ACACTTCCAGCGGCAGAGCAGCAAAGGTGCGCCTTTCTGGGCGCAGCGCTTCAGTCATCAATATCTCTAT
CAACTGCCCTGGTACATGATCATTGGCGCGCCAGGTGCCGGTAAAACCACCGCTCTGGTGAATTCCGGCT
TGCAGTTCCCACTGGCGGACAAGTTCGGTAAGGCTGCGCTACGTGGGATCGGCGGAACGCGTAACTGTGA
CTGGTGGTTTACTAACGAAGCCGTGCTGCTGGATACGGCGGGGCGCTATACCACGCAGGAGAGCCAGCAG
GAGCGCGATGCCGGCGAATGGCATCAGTTTCTCGACCTCCTGCGTAAATACCGTGGCCGTCAGCCGGTTA
ACGGCGTCATCGTCACCTTGAGCGTGGCAGACCTGTTATCACAGTCGCCCGAGGCCATGCGCAATCAGGC
CGTGGCGCTGCGCCAGCGTCTGATGGAGCTACACGATCGGCTCGGTATTCGCTTTCCGGTGTATGTCCTG
GTCACCAAAACCGACCTGTTAAAGGGGTTCCGCAGCTATTTTGCCAGCCTGGATAAGGCACAGCGCGAGC
AGATTTGGGGCTTTACCTTTCCGTGGGCCAAAGCATCAACGGCTGAATTTGAACTCAGCAGCCAGTTTCA
GCAGGAATATTCGCTGCTGCAACAGCGCCTGGATGCCGGACTTGCCGATGTGCTGCTGGCGGAAAGTGAT
GCCCAGGCACGTGCCGAAAGCTACCTGTTTCCACAGGAGTTTGCGGCATTGCGCCCTCAGTTGGCTGAGG
CGCTGGATATTCTGTTTGCGCGTTCCGATTTCGAAACGCAGTTCGCCCCGCGCGGCATCTACTTTGCCAG
CGGTACGCAGGAAGGCTTACCCTTTGACCGCGTAATGGGTGAACTCACGCGCGCCCTGCATCTGCCAGGC
CAGCAGCAGAGTGAGTCGGGCAGTTGGGACAAAGTGGATAAAGACGCGCCGATCCCTCAAAACAAAGGCC
AGAGCTTTTTCCTTAAGGGCGTGCTGGAAAATGTCATCTTCCAGGAGTCCGGTCTGGCCGGCAGTAACCG
CTGGTGGGAGCTACGTAACCGCGTGGGCCTGTGGTCGGGTTATCTGGCGTTACTGGTTATCGTACTCATT
GCCGGTGCACTGTGGCTGGTGAGCTATAACAAAAACAAAACCTACCTGCAGGAGATGGCGGCGAAAAGCC
CCCAGGTTGAGCAGCTCGGTGACAAGTTACAAAAAGAGGTGAACGGCAACCTCTTTGCACTGGTGCCTTA
CCTCAATACGCTGCTGCACCTGCCTGAGAGCGCCTCCTTTTCTCTGGAGCATCCGCCGCTCACGCGCCGG
ATGGGGCTGTATCGCGGAACGGAAGTCAGTGATGCGACCCAGGCCTTGTACGAAAGGGCGCTGAAACAGC
TGCTGATGCCGCAGGTTGCGCAGAATATCACCCGCTGGTTACGCAATGATACGGGAAGTGACGCTGACTA
CAGCTATGAGGCGCTCAAGGCTTATCAGATGCTGTACCAGCCAAAACACTATGACGGTAAGTTTCTTCAG
GCGTGGATGATGTTAAACATCTCGCGTGAATTGCCGCAGGACGTGACTCAGGCTGAGGTGAAACAGCTGG
CGTGGCATCTGCAACAGCTACTGGAAACGCAGATTCAGTCCTCGCCCTATGCGAAGGATGATGCGCTGGT
AAAGCGCGAGCAGGCGCTGATTAGTCAGATGCCGCTGTCACAGCGCGTTTACGGACGCCTGAAACGCCTG
CTGGAACGCGATGGCTCAATGTCACCGGTTACCTTGTCCGCGCTGGGTGGACCGCAAAGTGAACTGGTGT
TTTCCCGTAAAAGCGGTAAGTCTGTCAATGAAGGTGTTTCCGGGCTCTTTACGCCAGACGGCTACTGGAA
CCATGTGGATAAACAGATCGCGCCGGTCACGGATGCGCTCTACAAAGACGATATCTGGGTGCTGGGTGCA
GAGACGGCCCATGAAGACAGCAAACAAACCGACCTTGCGGTGCGCCAGCTCTATATTCAGGATTACATCC
GCCAGTGGGAGCAGTTTCTCAGCGATATTCAACTCAACAGCAGCGCCGATTTGACCCAACGTATTAATAC
GGCGCGCCTGCTGTCAGGGAATCATTCGCCGCTGCGGCAGTTAGTGATTAACCTGAGCAAACAGCTCACG
CTCACCCGGGCGCAGCCTGAAGACAAGAATGCCAAAGATACGGCCGCGTCATCGGATAACAGCGCCACAC
GAACGCTGCAGGCACTGTTTACCTCGCCGCGCGCAAACGGCGAGCAGGCGGTGGTGCAGCAAACGCCTGA
GCAGGCGGTGACCGCGCACTTTGCACCTGTCATTGAGCTGGCACAGCCGTTACAGCAGGGCAGTAAGGTC
CTGGCCGTTGATGATTTTCTTAAGCAGATCGACGATCTCTATCGCTATCTCACTGCCGTGCAGGATGCCG
CGAATAGCGGTATGCCACCGCCGGCGAGTGATGCCATTAGCCGTTTGCAGGCCAGCGCCGGACGTTTGCC
CGGTTCACTGCAAAATATGGTGTCAGGCATGGCAGTGGGCGCCAGCAGCGATGCACAGCGTCGCGACATG
GATAACGTTCGCAAGCGCATCACCATGGAAGTCGGCAGCTTCTGCCGTCAGGCGATAGCAGGCCGTTACC
CGCTGGTCCGGAATGCACGCAGCGAAGTCACGCCTGATGACCTGGCGCGCATGTTTGCGCCGGGAACCGG
ACTGATGGACAGCTTCTTCCGCGATAATCTGGCCAGCAAAGTGGATACCACGCGCGCGGCATGGCGCTTC
ACGCCCGGCATTGATGGCAAAACCTTGCCAGGTGGCGAAGCCTTGCTGCGTCCTTTCCAGCAGGCGCAGT
CGATTCGCGACGCCTTCTTTGCCAATGGGGCCACTACGCCATCCTTCCGCGTCACGTTACGGACGGTGAA
GATGGATAACGATATCCTGAATATGACGCTGGATGTCGATGGACAGATTTTGCGCTACAGTCATGGACCA
CAGGCAGTGCAGTTAGTGAGTTGGCCCGGACCAGGTGGAACCAGTCAGGTGCGCATGCAACTGGGGCTAA
CGAACGGCACGACCTCAACCCTGACCACCAGCGGCCCATGGGCGCTTAATCGCTTCTTTGATCGCGCACG
GGTGACGTCGGTAGGTGGACTGACTCGCGAAGCCAGCTTTAGTGTGGACGGCCATAATGTGACGCTGTCA
TTCACGCCAGGCAGCATTCGTAATCCTTTCCAGCTACCCGCATTTAGCTGTCCCTGA
 Primer design