SecReT6
Protein ID: 291617923
SecReT6 ID384
T6SS typei3
Gene symbolytxE
Locus tagPANA_2370
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2642883..2644124 [-]
Producthypothetical protein
NoteTssL
UniProt IDD4GHM0
KEGG IDpam:PANA_2370
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.30E-71, Aligned region: 21..226
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|291617923|ref|YP_003520665.1| hypothetical protein PANA_2370 [Pantoea ananatis LMG 20103]
MMQEQNKPNSDAFQQDLSHQNSLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRRFELACQQSGLS
YEVIVGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQLLAKLSQNPRQHILLLELI
YFCLLLGFEGRYRVLDNGRSQLDTIKQRLLQMIRSVRGSFAAALSPHPTDQPVLRKLWRPMIPLWACAAL
AGLAACLFYIVLNWRLGDYTSPVLAKIYQTTLPEVQIRNPAPPPPPSLNLKSFLKPEIDEGLVAVRDEAD
QSVVTLKGDGLFASGSTEVRGRYDAVIQRVAEAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQS
VQTLLQKQLAKPSRVKAEGRGETHPLVPNTSAENRARNRRVEITLQVAPDTTQAEVNGLARGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2644124-2642883 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGATGCAGGAACAAAATAAACCGAACAGTGATGCTTTTCAGCAGGATCTTAGCCACCAGAATAGTTTGG
TGGCTGCAGCGAATCCGCTGATTAACGCGATTCCACAGATTCGTCACTCCGTCTCCCATGACGATCCCGC
ACGTTTACGTCAACAGCTTATTGACCAGATCCGCCGTTTCGAGCTGGCCTGCCAGCAGTCTGGACTGAGC
TATGAGGTGATCGTTGGCGCGCGCTATTGTCTGTGTACGGCGCTTGATGAAGCCGCAGCACTGACGCCCT
GGGGAAGCCGTGGCGTGTGGACCAGTAATGGCTTACTGGTCACCTTCCACAACGAAACCTGGGGCGGGGA
GAAATTCTTCCAGTTGCTGGCGAAACTGTCGCAGAACCCGCGTCAGCACATCCTGTTACTGGAGCTGATC
TATTTCTGCTTACTGCTTGGTTTTGAAGGGCGCTATCGGGTTCTGGATAACGGACGCTCGCAACTGGATA
CGATTAAACAGCGTCTGTTGCAGATGATCAGGAGCGTCAGGGGCAGCTTTGCCGCCGCCTTGTCGCCGCA
TCCGACCGATCAGCCGGTTCTGCGTAAACTCTGGCGCCCCATGATTCCGCTGTGGGCCTGTGCGGCTCTG
GCGGGCCTGGCTGCCTGCCTGTTCTATATCGTGCTGAACTGGCGTCTGGGGGATTACACCTCGCCCGTGC
TGGCCAAAATCTACCAAACGACGCTGCCAGAAGTGCAGATTCGTAATCCGGCACCGCCGCCGCCGCCGTC
ACTGAACCTGAAGTCATTCCTGAAACCTGAAATCGACGAAGGCCTGGTGGCCGTGCGCGATGAGGCAGAT
CAAAGTGTGGTGACGCTGAAAGGCGATGGCTTGTTCGCATCCGGTTCGACAGAGGTTCGCGGACGTTATG
ATGCCGTTATCCAGCGTGTAGCTGAAGCCATGAATAACGTCAGCGGAAAAATCCTGGTGGTGGGCTACAG
CGATAACGTACCGATTCGCAGTGCCCGATTTGCCTCCAACTATGAGCTGTCTCTGGCCCGTGCCCAGTCT
GTTCAGACGCTGTTACAAAAACAGCTGGCAAAACCATCACGCGTTAAAGCGGAAGGGCGGGGTGAAACGC
ATCCGTTGGTGCCGAATACCAGTGCAGAAAATCGCGCGCGTAATCGTCGTGTTGAAATTACGCTGCAGGT
TGCACCTGATACGACGCAAGCTGAAGTTAACGGCCTGGCGAGAGGGAACTAA
 Primer design