SecReT6
Protein ID: 291617924
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2371
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2644141..2645487 [-]
Producthypothetical Protein
NoteTssK
UniProt IDD4GHM1
KEGG IDpam:PANA_2371
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-150, Aligned region: 21..444
Protein Sequence: 448 a.a.     [Download]
>gi|291617924|ref|YP_003520666.1| hypothetical Protein PANA_2371 [Pantoea ananatis LMG 20103]
MIMNRAEKVVWAEGMFLRPHHFQQAENFLQSSLREWGQSQRPYVWGFFDLEFDEALLRQGKLALSAASGC
LPDGTFFAFSQPQHGPAPLDVPSNTDRAKVVLAIPARRNGREAVTFQDAPDSLARYLAWEAEVEDDNAQA
VGTATVQFGKLRLRLMLEQDLTAEWTAMGVAQIVEKRSDNHIRLDNDYIPPTLTLAGSRPLQSMMTDLHG
MIQQRSQQLSQRAPGTGRFNSADMVDFMLLALLNRQLGLHAHLQHLPLLHPETLYSHWLQLAAELATWTE
ARTPDAFPLYDHDDLQGCFSRLTLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPDNSMVREFGFVLAV
KANVPADALKTHFPAQMKVAPVTKIRDLVQLQLPGLALKAMPGAPPQIPWHAGYSYFELDKNSELWQEME
RSGAFALHLAGEFPGLNMEFWAIRSQSE
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2645487-2644141 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGATTATGAACAGAGCCGAAAAGGTTGTTTGGGCGGAAGGGATGTTTTTACGTCCTCACCATTTCCAGC
AGGCAGAAAACTTTCTGCAAAGCTCGCTGCGTGAATGGGGCCAGTCGCAACGCCCTTATGTTTGGGGATT
TTTCGATCTCGAATTTGATGAAGCGCTGTTGCGGCAGGGTAAACTGGCACTGAGCGCCGCCAGTGGATGC
CTGCCGGATGGAACGTTTTTTGCCTTCAGTCAGCCACAACACGGCCCTGCGCCGCTGGACGTTCCCAGCA
ATACCGACCGCGCCAAAGTGGTTTTGGCCATTCCCGCTCGCCGCAATGGTCGCGAGGCGGTGACGTTTCA
GGACGCGCCTGATTCGCTGGCTCGCTATCTGGCCTGGGAAGCGGAAGTTGAAGATGACAATGCGCAGGCT
GTCGGAACGGCCACCGTTCAGTTTGGCAAGCTACGCCTCCGCTTGATGCTGGAGCAGGATCTCACGGCGG
AATGGACGGCGATGGGCGTTGCTCAGATCGTTGAAAAGCGCAGCGACAACCATATCCGTTTAGACAATGA
TTATATCCCTCCCACGTTAACCCTTGCTGGCAGTCGTCCGCTTCAGAGCATGATGACCGACCTGCACGGC
ATGATTCAACAACGTAGCCAGCAGCTGAGCCAGCGCGCACCCGGAACGGGCCGCTTTAACAGCGCGGATA
TGGTTGATTTTATGCTGCTGGCGCTGCTTAACCGCCAGTTGGGCCTTCATGCGCATCTGCAGCATCTGCC
GCTGTTACATCCCGAAACCCTCTACAGCCACTGGCTGCAGCTGGCTGCTGAGCTGGCAACGTGGACAGAG
GCGCGCACGCCGGATGCTTTCCCTCTCTATGACCACGACGACCTGCAGGGCTGCTTCTCGCGCCTGACGC
TATTGCTTCGTCAGGGCCTGTCGCAGGTGATGGAAGAGAGCGCCATTCAGTTGCCGCTTACGCAACGCTC
ACACGGCCTGAACGTGGCGACCGTGCCGGATAACAGCATGGTGCGTGAATTCGGTTTTGTGCTGGCCGTA
AAAGCAAACGTCCCGGCCGACGCGCTGAAAACGCATTTCCCGGCGCAGATGAAAGTCGCCCCCGTCACCA
AAATTCGCGATCTCGTCCAACTGCAGCTACCAGGCCTTGCCCTGAAAGCCATGCCGGGGGCGCCACCGCA
GATCCCATGGCACGCAGGATACAGCTATTTTGAGCTGGATAAGAACAGCGAGCTATGGCAGGAGATGGAG
CGATCGGGTGCCTTCGCGCTGCACCTTGCCGGTGAGTTTCCGGGCCTGAACATGGAGTTCTGGGCCATTC
GCAGTCAGTCAGAATAA
 Primer design