SecReT6
Protein ID: 291617925
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2372
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2645503..2646006 [-]
Producthypothetical Protein
NoteTssJ
UniProt IDD4GHM2
KEGG IDpam:PANA_2372
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-27, Aligned region: 19..143
Protein Sequence: 167 a.a.     [Download]
>gi|291617925|ref|YP_003520667.1| hypothetical Protein PANA_2372 [Pantoea ananatis LMG 20103]
MAQTYFRVGLAKWIWPFLLLLLTACSSSKPDIARYNLHFQAHPSINSGAPLKVRVMLLTSDAEFMSADFF
TLQNQPATALGNTLLNNQQFFLMSGQLSKTLSAKSLPDARFIGIMAEYQKLDGKVWRLALPFPDSDSSSF
WQFWKSNDGELNANIIVDDAGMRPVKQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2646006-2645503 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGCACAAACTTACTTTCGCGTTGGCCTGGCAAAATGGATCTGGCCCTTCCTGCTGCTTCTGCTAACGG
CATGCAGTAGCAGTAAGCCTGATATCGCGCGATACAACCTGCACTTTCAGGCTCATCCTTCCATCAATTC
GGGCGCACCTCTCAAAGTCCGGGTGATGTTGCTGACGTCTGATGCAGAATTTATGTCCGCCGACTTCTTC
ACTTTGCAGAATCAACCCGCTACCGCACTGGGAAATACGCTACTCAACAATCAGCAGTTTTTCCTGATGT
CCGGTCAGCTCAGTAAAACGCTGAGTGCCAAAAGCCTTCCCGACGCGCGCTTTATCGGCATCATGGCGGA
ATATCAAAAGCTGGATGGCAAGGTGTGGCGACTTGCGCTGCCTTTCCCAGACAGTGACAGCAGCTCGTTC
TGGCAGTTCTGGAAAAGCAATGATGGTGAGTTAAACGCCAACATTATCGTTGACGATGCCGGCATGCGTC
CCGTTAAGCAATAA
 Primer design