SecReT6
Protein ID: 291619691
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4138
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4592409..4595942 [-]
Producthypothetical Protein
NoteTssM
UniProt IDD4GFI5
KEGG IDpam:PANA_4138
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.40E-69, Aligned region: 451..769
DUF1215 [PF06744], Evalue: 3.80E-32, Aligned region: 244..261
DUF1215 [PF06744], Evalue: 3.80E-32, Aligned region: 602..630
DUF1215 [PF06744], Evalue: 3.80E-32, Aligned region: 892..1012
PMT [PF02366], Evalue: 0.00071, Aligned region: 33..87
Protein Sequence: 1177 a.a.     [Download]
>gi|291619691|ref|YP_003522433.1| hypothetical Protein PANA_4138 [Pantoea ananatis LMG 20103]
MEHAHYPNCFPTGDGSVKLPLAPKTTEGRYLAVALIFFLLLAVMTFMVWKHPDIAGIEDGSQQQIYWLIA
GGCISGCALIVSVVLLAAVRSAGKQEFNALVDNINGDDEKKKRENDKAPVHPAVAMCNKIRGHLRSRIGL
YWRRKTRLLLITGDEAAIEQLVPGLQENQWLEGNRTVLIYGGSLTAEPDKEKYTALRKLRRGRPLDGIVR
VLPQSLNLTPQVSDNDLRGLEKISELLRYSAPVWLWQLCDSSWSQAKRPEQAVGAAFPLRADQSDIVRQL
ELMLPALREQGMSQVLENNGHDFLLRLGRQLQDGGIARLAQQLVPWLAVSQQRVPLRGLMFSLPENKPAS
TAEETAGAAPADAEKYIPASQRHALTLPVTWQGIVDDCTRVRGRRVGLAWENTLARTLMAVIGIWGAGTL
LSFAANRQQIVSVAQQAHALVAHPAVSDDQLTALHRLRNEAGRLQHRIQEGAPWYQRFGLDHNAQLLGAV
LPWYGVANNRLIRDPANQALTQKLSALANTAPNSDQRAQLAKPGYDQLKAWLMMARPDKADGAHYARTLK
AVQPTRTGISTGLWQSLSPDLWAFYITELPEQPQWTITPDAQLVSQSRQVLLQQIGRRNAESTLYENMLK
SLRRNFAEVSLEDMTSGTDARRLFTTEEVVPGMFTRQAWEGGIQQAIDKAANSRRDEIDWVLSDSGRDVS
ADLSPEALKARLTQRYFTDFAGSWLSFLNSLRLNPANNIADVTDQLTLMSDIRQSPLIALMNTLAWQGQT
GQQSEGLSDSIIKSARELVGGKDKPAIDQSATGPRGPLDETFGPLLQLLGKNTGSNVMSADNSLSLQTYL
TRITRVRLRLQQVAGTSDPQAMMQTLAQTVFQGKSVDLTDTRQYGSLIAASLGEEWSGFGSTVFVQPLTR
AWESVLGPSAAGLNDKWSRSVVANWQTAFDGRFPFAASKSDASLPVLAEFVRKDSGRIERFLATELSGVL
HREGSQWVPDRVNSQGLSFDPAFLRAINQLSRLSDILFTDGSQGLSFELQARPVPQVVETQLTIDGQKLH
YFNQMAGWQRFRWPGETYRPGTMLTWTTVSAGARLFGDYSGTWGLIRWLEQGRREQLDHSRWMMSFTAPD
GRTLQWVLRSQHENGPLALLDLRGFTLPDQIFSVDSAIADRALIAHTGNSEADGIEP
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4595942-4592409 Pantoea ananatis LMG 20103 chromosome, complete genome
GTGGAGCACGCTCATTACCCCAATTGCTTCCCGACAGGAGATGGATCCGTGAAGCTACCTTTAGCACCGA
AGACTACGGAAGGCCGCTATCTTGCTGTCGCATTGATTTTCTTTTTGCTGTTAGCCGTTATGACGTTCAT
GGTCTGGAAGCATCCGGATATAGCCGGGATTGAAGACGGAAGTCAGCAGCAAATCTACTGGCTTATCGCC
GGAGGATGTATTTCAGGCTGCGCCCTTATCGTATCCGTAGTGCTGCTGGCGGCAGTTCGTAGTGCCGGTA
AGCAGGAGTTTAATGCGCTTGTCGACAATATCAACGGTGATGATGAGAAAAAGAAACGGGAAAATGATAA
AGCGCCTGTTCACCCTGCGGTGGCCATGTGTAACAAGATTCGGGGACATCTCCGCTCCCGTATTGGCCTT
TACTGGCGTCGTAAAACCCGTCTGTTGCTCATCACTGGCGATGAGGCGGCAATCGAACAGCTGGTACCTG
GCCTGCAGGAAAACCAGTGGCTTGAAGGCAACCGCACTGTGCTGATTTACGGCGGCAGCCTGACTGCTGA
GCCCGATAAGGAAAAATACACCGCGCTGCGTAAACTGCGTCGCGGACGACCGCTGGACGGGATTGTCCGC
GTACTGCCGCAGTCGCTTAATCTGACCCCGCAGGTCAGCGACAACGATTTACGCGGGCTGGAAAAAATCA
GTGAACTGCTGCGTTATTCCGCCCCGGTCTGGCTGTGGCAGCTGTGCGACAGCAGTTGGTCGCAGGCAAA
ACGTCCAGAGCAGGCGGTGGGGGCAGCCTTTCCGCTGCGCGCAGACCAGAGCGACATTGTCCGCCAGCTT
GAGCTGATGCTGCCGGCCCTGCGGGAGCAGGGGATGAGTCAGGTGCTCGAGAATAACGGCCACGACTTCC
TGCTGCGTCTGGGCCGGCAGCTGCAGGACGGCGGTATCGCCCGACTGGCTCAGCAGCTGGTGCCCTGGCT
CGCCGTCTCACAGCAGCGCGTTCCGCTGCGTGGCCTGATGTTCAGCCTGCCGGAGAATAAACCCGCCTCT
ACCGCAGAAGAAACAGCCGGTGCTGCACCTGCCGACGCTGAGAAATATATCCCGGCATCACAACGCCATG
CGCTGACGCTGCCGGTAACCTGGCAGGGCATTGTGGATGACTGTACCCGCGTGCGTGGCCGCCGGGTCGG
CCTGGCGTGGGAGAACACGCTCGCCCGGACGCTGATGGCGGTTATCGGTATCTGGGGCGCAGGAACCCTG
CTCTCGTTTGCGGCCAACCGCCAGCAGATTGTCTCTGTGGCGCAGCAGGCGCATGCCCTGGTGGCGCATC
CTGCCGTATCAGATGACCAGCTGACGGCTCTGCACAGGCTGCGCAACGAAGCCGGTCGCCTGCAGCACCG
TATTCAGGAAGGTGCGCCCTGGTATCAGCGCTTTGGTCTGGACCATAATGCGCAGCTGCTGGGTGCGGTG
CTCCCCTGGTACGGCGTGGCGAACAACCGCCTGATACGCGACCCGGCGAATCAGGCGCTGACACAGAAAC
TCAGCGCACTGGCAAACACTGCCCCCAACAGCGACCAGCGTGCACAGCTGGCGAAGCCGGGTTATGACCA
GCTTAAAGCCTGGCTGATGATGGCCCGGCCGGATAAAGCCGACGGCGCGCACTACGCACGGACCCTGAAA
GCCGTGCAGCCGACGCGAACGGGTATTTCCACCGGCCTGTGGCAGAGCCTGTCGCCTGATTTATGGGCCT
TCTATATCACCGAACTGCCTGAACAGCCGCAGTGGACAATCACGCCGGATGCGCAGCTGGTCAGCCAGAG
CCGCCAGGTGCTGCTGCAGCAGATTGGACGCCGCAACGCGGAAAGCACGCTGTATGAAAACATGCTCAAA
TCCCTGCGCCGTAACTTTGCCGAGGTCTCTCTTGAAGACATGACCAGCGGAACGGATGCGCGGCGACTGT
TCACCACCGAAGAGGTGGTGCCGGGCATGTTCACCCGCCAGGCCTGGGAAGGCGGCATTCAGCAGGCGAT
TGATAAGGCTGCTAACTCACGCCGGGATGAAATCGACTGGGTGCTGAGCGATTCCGGCAGGGACGTCTCC
GCGGACCTGTCGCCGGAGGCCCTGAAGGCGCGCCTGACGCAGCGTTACTTCACCGACTTTGCCGGCAGCT
GGCTGAGCTTCCTGAACAGCCTGCGTCTTAACCCGGCGAACAATATTGCAGACGTGACCGACCAGCTGAC
GCTGATGAGTGATATACGCCAGTCGCCACTGATAGCCCTGATGAATACCCTCGCCTGGCAGGGGCAGACC
GGCCAGCAAAGCGAAGGTCTTTCGGACTCCATCATCAAATCGGCCAGAGAGCTGGTTGGTGGAAAAGACA
AACCCGCAATTGACCAGTCAGCGACAGGTCCCCGGGGGCCGCTGGATGAAACTTTCGGTCCGCTGCTTCA
GCTTTTGGGTAAAAACACGGGCAGTAACGTCATGTCGGCTGACAACTCGCTGAGCCTGCAGACGTATCTG
ACCCGTATCACCCGCGTGCGGCTGCGGCTGCAGCAGGTGGCCGGCACCTCCGATCCACAGGCGATGATGC
AGACCCTGGCGCAGACCGTATTTCAGGGCAAAAGCGTGGACCTGACCGACACCCGGCAGTACGGCAGTCT
GATTGCGGCAAGTCTGGGGGAAGAGTGGAGCGGGTTTGGCAGCACGGTGTTTGTGCAGCCGCTGACCCGG
GCCTGGGAGAGCGTGCTTGGGCCGTCGGCGGCGGGCCTGAATGACAAATGGAGCCGGTCCGTGGTGGCGA
ACTGGCAGACGGCCTTTGACGGGCGCTTCCCGTTTGCGGCGAGCAAAAGTGATGCCTCCCTGCCGGTGCT
GGCTGAGTTTGTGCGCAAGGACAGCGGACGCATTGAGCGCTTCCTGGCAACGGAGCTCAGCGGCGTGCTG
CACAGAGAGGGCAGCCAGTGGGTGCCGGACAGGGTCAACAGCCAGGGGCTGAGCTTTGACCCGGCCTTCC
TGCGGGCCATTAACCAGCTGAGCCGGCTGTCAGACATTCTGTTCACCGACGGCAGTCAGGGGCTCAGCTT
TGAGCTGCAGGCGCGCCCGGTACCGCAGGTGGTGGAAACGCAGCTGACCATTGACGGACAGAAGCTGCAC
TACTTCAACCAGATGGCCGGCTGGCAGCGTTTCCGCTGGCCGGGAGAGACGTACAGGCCGGGGACCATGC
TGACCTGGACCACGGTCAGCGCCGGTGCGCGCCTGTTCGGTGATTACAGCGGCACCTGGGGGCTGATCCG
CTGGCTGGAGCAGGGCAGGCGGGAGCAGCTTGACCACAGCCGGTGGATGATGAGTTTTACCGCGCCGGAT
GGCCGGACCCTGCAGTGGGTGCTGCGCTCTCAGCACGAAAACGGTCCGCTGGCGCTGCTGGACCTGCGCG
GCTTCACGCTGCCGGATCAGATATTCAGTGTTGACAGCGCGATTGCCGATCGGGCGCTGATAGCTCACAC
AGGAAACAGTGAAGCAGACGGAATCGAACCATGA
 Primer design