SecReT6
Protein ID: 292489491
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3024
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3128425..3132057 [-]
Producttype VI secretion system core protein
NoteTssM
UniProt IDD4I0R3
KEGG IDeam:EAMY_3024
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.40E-102, Aligned region: 208..488
IcmF-related [PF06761], Evalue: 5.50E-85, Aligned region: 536..839
IcmF-related [PF06761], Evalue: 5.50E-85, Aligned region: 854..888
DUF1215 [PF06744], Evalue: 2.40E-30, Aligned region: 952..1076
Protein Sequence: 1210 a.a.     [Download]
>gi|292489491|ref|YP_003532379.1| unnamed protein product [Erwinia amylovora CFBP1430]
MLNMLFAVLTHRLLWGFVGITALSFIIWVIGPVFSIVDSRPLAPEVNRQISIGLLYLVWALGNLVPRLYN
AWLNRKLMGSLKTTPGEQPDGDNPRLTSEDRVLAERFNEASELLKKAHFTHADGRRSPFWAQRFSRQYLY
QLPWYVIIGAPGAGKTTALVNSGLQFPLADRFGKSALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQ
QQDAGEWQGFINLLRKYRARQPINGVIVTVSVSDLLTQSAEAAQQQAVALRQRLTELHEQLGIRFPVYVL
VTKTDLLKGFRAYFAQFDKAQREQIWGFTFPWERAKMSDFDLPTAFSQEYALLQQRLDAGLADTLLQESD
VKARAESFLFPQEFAALRPLLAEYLDTVFARSDFETQFSPRGIYFASGTQEGLPFDRVMGELNRALQLPQ
QDAASGQSGSWDQTSKAAPIPGNKGQSFFLKDVLQKVIFPESGLAGSNRWWELRNRALLWSGYIALAAAL
VISALLWFTSYGNNKSYLQQVQARVPEVVRQSSALQGSEQGDLFALLPLLNSLLKLPESSEFDLNSPPIS
RRMGLYRGAEVSDATQALYQKSLKQLLLPQVAQSIAGWLRNDNGSDADYSYEALKAYQMLYQPQHYDGKF
LHAWLMLNLQRNLPQNVTQAQLKQLEWHLSQLLENQIQASPYARDDALVKREQALINQMPLSQRVWGRLK
RLLERDESLKPVSLASLGGPQSELVFSRKSGGSIADGISGLFTPDGYWQSFDKHIAAVTTALHDDDRWVL
GAQSAGESQQQTDAAVRQLYISDYIRQWDGLLQDIQLNNSADLAQRINSARLLSSNNSPLRKLVINLSRY
LVLEKLPTDEKQAGKDKDADADNSAARTLQALFRSRQNSAAAAADQAPEQAVANHFAPVIELAQPLEQGG
KTIAFDDFIRQIDDLYRYLTAVQDAANSGMPPPAGDAISHLQASAGRLPGSLQTVFSTLAVGASSDAQRR
ELENVRKRISSEVGGFCRQAIAGRYPLVRSARSEVTPDDLARMFAPGNGLMDSFFRDNLANKVDTTQPAW
RFTPGIDGKGIGGEDILRPFQQAQSIRDAFFANGATTPAFRVTVRTLRMDNDILNLTLDVDGQLLRYSHG
PQAVQLMNWPGSGGTSQVRMQLGLANGTTSTLVTNGVWALNRFFDRAQLAPGSSSLSRQASFNVDGHRVT
LEFTPNSIRNPFQLSGFSCP
 
Nucleotide Sequence: 3633 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3132057-3128425 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGTTGAATATGCTGTTTGCCGTTTTAACCCATCGCCTGCTGTGGGGCTTTGTGGGGATTACCGCGCTGT
CGTTTATTATCTGGGTAATTGGCCCGGTATTTTCGATAGTCGACTCGCGCCCGCTGGCGCCGGAAGTCAA
CCGCCAGATCAGTATTGGCCTGCTTTATCTGGTGTGGGCGCTGGGCAACCTGGTGCCGCGCCTGTATAAC
GCCTGGCTGAACCGCAAGCTGATGGGTAGTCTGAAAACCACTCCCGGCGAACAGCCGGACGGCGACAATC
CGCGCCTGACCAGCGAAGACCGGGTGCTGGCTGAACGCTTTAACGAAGCCTCCGAGCTGCTGAAAAAAGC
GCATTTCACTCACGCCGACGGCCGCCGCTCGCCGTTCTGGGCGCAGCGCTTCAGCCGCCAGTATCTCTAT
CAGCTGCCGTGGTATGTGATCATCGGCGCGCCGGGTGCCGGAAAAACCACCGCGCTGGTCAACTCCGGGC
TGCAGTTCCCGCTGGCCGACCGCTTTGGCAAATCCGCGCTGCGCGGTATTGGCGGCACGCGCAACTGTGA
CTGGTGGTTTACCAATGAAGCGGTGCTGCTGGATACCGCCGGGCGCTACACCACTCAGGAGAGCCAGCAG
CAGCAGGATGCCGGAGAATGGCAAGGCTTTATCAATCTGCTGCGTAAATACCGCGCCCGCCAGCCAATCA
ACGGGGTGATTGTTACCGTCAGCGTTTCCGATCTGCTCACCCAGTCGGCCGAGGCTGCGCAGCAGCAGGC
GGTGGCGCTGCGCCAGCGCCTGACCGAACTGCATGAACAGCTGGGCATTCGTTTTCCGGTCTACGTGCTG
GTCACCAAGACCGACCTGTTGAAAGGCTTTCGCGCCTACTTTGCCCAATTCGACAAGGCCCAGCGTGAAC
AGATCTGGGGCTTCACCTTCCCGTGGGAACGGGCGAAGATGAGCGATTTTGACCTGCCGACGGCGTTCAG
CCAGGAATATGCGCTGCTGCAACAGCGGCTGGATGCCGGACTGGCGGACACCTTGCTCCAGGAGAGCGAT
GTAAAGGCGCGCGCCGAAAGTTTCTTATTCCCACAGGAATTCGCCGCGCTGCGTCCGCTGCTGGCGGAGT
ATCTGGACACGGTATTTGCCCGATCTGACTTTGAAACCCAGTTCTCACCGCGTGGGATTTACTTCGCCAG
CGGCACCCAGGAAGGGCTGCCGTTTGACCGGGTAATGGGCGAACTTAACCGCGCCTTACAGCTGCCGCAG
CAGGATGCGGCCAGCGGCCAGAGTGGCAGCTGGGACCAGACCAGTAAAGCGGCACCAATCCCCGGCAACA
AGGGGCAGAGCTTCTTCCTGAAAGACGTGCTGCAAAAAGTGATTTTTCCCGAGTCCGGGCTGGCGGGCAG
CAACCGCTGGTGGGAACTGCGTAACCGGGCGCTGCTGTGGTCGGGCTATATCGCCCTCGCCGCCGCGCTG
GTGATTAGCGCACTACTGTGGTTTACCAGCTACGGCAACAACAAAAGCTATCTGCAACAGGTGCAGGCGC
GGGTGCCGGAAGTGGTGCGGCAGAGCAGTGCGCTACAGGGCAGCGAGCAGGGCGATCTGTTTGCCCTGCT
GCCATTGCTGAACAGCCTGTTGAAGCTGCCGGAAAGCAGCGAATTTGACCTCAACTCGCCGCCGATAAGC
CGCCGTATGGGGCTGTATCGCGGAGCCGAGGTCAGCGATGCCACCCAGGCGCTGTACCAGAAATCGCTGA
AACAGCTGCTGCTGCCGCAGGTGGCGCAGTCGATCGCCGGCTGGTTGCGTAACGACAACGGCAGCGATGC
CGACTACAGCTATGAGGCGCTGAAAGCCTATCAGATGCTGTATCAGCCGCAGCACTATGACGGCAAGTTC
CTGCACGCCTGGCTGATGCTCAACCTGCAGCGTAACCTGCCGCAAAACGTCACGCAGGCGCAGCTGAAAC
AGCTGGAATGGCATCTCAGCCAGCTGCTGGAAAACCAGATCCAGGCTTCTCCCTATGCGCGGGATGACGC
GCTGGTAAAGCGCGAGCAGGCGCTGATTAACCAGATGCCGCTGTCACAGCGCGTCTGGGGGCGGCTTAAG
CGCCTGCTGGAACGCGATGAAAGCCTGAAACCGGTGTCGCTGGCCTCTCTCGGCGGCCCGCAGAGCGAGC
TGGTGTTTTCGCGCAAAAGTGGCGGCTCGATTGCCGATGGCATTTCCGGCCTGTTTACCCCGGACGGCTA
CTGGCAAAGCTTTGATAAGCATATCGCTGCGGTCACGACGGCGCTGCATGACGACGACCGCTGGGTGCTG
GGCGCACAATCAGCCGGGGAGAGCCAGCAGCAAACCGATGCGGCGGTGCGCCAGCTGTATATCAGCGACT
ACATCCGCCAGTGGGATGGCTTGCTACAGGATATTCAGCTGAACAACAGCGCCGATCTTGCCCAGCGCAT
CAACAGCGCGCGGCTGCTCTCAAGTAACAATTCGCCGCTGCGTAAGCTGGTGATTAACCTCAGCCGCTAC
CTGGTGCTGGAAAAACTGCCGACGGATGAAAAACAGGCGGGCAAGGATAAGGATGCCGATGCTGATAACA
GCGCTGCCCGCACCCTACAGGCGCTGTTCCGTTCGCGGCAGAACAGCGCGGCGGCGGCGGCAGATCAGGC
GCCTGAACAGGCGGTTGCCAACCATTTTGCGCCGGTTATCGAACTGGCGCAGCCGCTGGAGCAGGGCGGA
AAAACCATCGCTTTTGATGACTTCATCCGCCAGATCGATGACCTGTACCGCTACTTGACGGCGGTGCAGG
ATGCGGCCAACAGCGGTATGCCGCCGCCCGCCGGGGATGCCATCAGCCATTTGCAGGCCAGCGCCGGACG
CTTACCCGGTTCGCTGCAAACCGTATTTTCCACCCTTGCGGTTGGTGCCAGCAGTGACGCACAGCGCCGC
GAACTGGAAAACGTGCGCAAGCGCATCAGCAGCGAAGTCGGCGGCTTCTGCCGTCAGGCGATTGCCGGCC
GCTACCCGCTGGTGCGTTCGGCGCGCAGCGAAGTCACCCCGGACGACCTGGCTCGTATGTTTGCCCCCGG
CAACGGCCTGATGGACAGCTTCTTCCGCGATAACCTCGCCAATAAAGTCGATACCACGCAGCCAGCCTGG
CGCTTTACGCCGGGTATTGACGGCAAGGGCATCGGCGGCGAAGACATACTGCGTCCGTTCCAGCAGGCGC
AAAGCATCCGCGATGCCTTCTTTGCTAACGGTGCCACCACGCCAGCGTTTCGCGTGACGGTGCGCACGCT
GCGCATGGATAACGATATTCTTAATCTGACGCTGGATGTTGACGGCCAGCTACTGCGTTACAGCCACGGG
CCGCAGGCGGTACAGCTGATGAACTGGCCCGGCAGCGGCGGCACCAGCCAGGTGCGTATGCAGCTTGGGC
TGGCGAATGGCACTACCTCGACGCTGGTGACTAACGGCGTCTGGGCGCTGAATCGCTTCTTTGACCGTGC
GCAGTTAGCGCCGGGCAGCAGCAGCCTGAGCCGTCAGGCCAGTTTTAACGTTGACGGCCATCGCGTGACG
CTGGAGTTTACTCCGAACAGCATCCGCAATCCGTTTCAGCTTTCCGGATTCTCATGCCCGTAG
 Primer design