SecReT6
Protein ID: 292489679
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3216
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3307823..3311194 [-]
Producttype VI secretion system core protein
NoteTssM
UniProt IDD4I223
KEGG IDeam:EAMY_3216
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-69, Aligned region: 420..731
DUF1215 [PF06744], Evalue: 1.40E-33, Aligned region: 853..973
Protein Sequence: 1123 a.a.     [Download]
>gi|292489679|ref|YP_003532569.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSKVKVKTLIGSVVTVAFFLTVIVGFVFYAFPANVASLTGVGPYDGLRIFAFCAALVAALILLGWLVEKV
FDFAGQSGLYFHWGQNKDQVVSPMRQTIASEEDDIEPLFSEEQVTEHLRLRYGRRWQRKVRILLVMGNRD
NVQKAAPGLIHDLWQEGDGDVLIYGGDAQSLSDDVFFSKLKRLRSANPLDGIVQVINSLALPDDIACDAF
LRCRQKADNLLGWQAPVWLWLTDEAIGLQEGRADVATGVMFGPGAAPGDISATLDALVPRLRSAGIAQLL
GDAQHDGFLSLSSRLHGELKERLNVLLGALMQGSAAYRLRGVVFSPELSVAGSVPNTRLDTPTWKAVIDD
CDAVRPKKLTFDCIRGLRLALLTLITLWGAGTMVSLAVNRAQIYQAQETARLAADTKQPLTERLRNQLVL
QQAIARLQNREASGAPWYTRFWLNQDGDTLTALWPLYARNNALLMRDATTAQFTRQLNAFVQLPPASSAR
AQGTQRTYGVLKSYLMMARPDKAEAGWLAKNVLMAWPKRHGVPEGSWQELAPKLLGFYAQNLPAHPEWKI
KPDAGLIGNVRQILLKQIGQRNAESGLYQDMLKRVASNWPDLTLADMTGDTDASTLFRTEEVVPGMFTRQ
AWEEQVQDAINEMVITRRDEIDWVLTDKSLQPASDVSPEALKTRLIERYFTDFGNAWLNMINSIQWQEAT
SLSEAIAQLNLIGDVRQSPLVALMNALGWQGKTGQKGGALADSIVNSAKKLIGSKTKPQQFIEQGQTAKG
PLDGLFGPLLGVMEGKDSSGGNGSLSFQSWLARVTQVRLKLQQVTSAPDPQAMSQMLAQTVFQGKATDLT
DTRDYGSLLAASLGQEWSGFGQSLFVQPLDLAWRQVLAPAAESLNARWQSTIVDQWHTAFAGRYPFKVTG
SDASLPLLAQFLRSDSGRITRFLKTNLGGILHQEGNRWVVDPAASQGMVVHPDFLRAINQLAELSDIVFA
QGDAGIHFELMARPSRDVARMRLTLNEQNLDYFNQMESWQNFAWPGNTYYPGASLSWRSVNTGMQLYASN
PGNWGFIRLLGHAQITPLDGSRTQLVWAAPDGNPLKFVMRSELGDGPLALLKLQGFTLPESIFSVGKARR
QKE
 
Nucleotide Sequence: 3372 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3311194-3307823 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGTCTAAGGTAAAAGTCAAAACGCTCATTGGCTCCGTCGTCACTGTCGCCTTCTTCCTGACAGTCATCG
TTGGGTTTGTGTTTTATGCCTTTCCGGCAAATGTTGCTTCGTTAACCGGGGTTGGACCCTATGACGGTCT
ACGCATTTTCGCATTCTGTGCCGCGCTGGTGGCCGCGCTTATTCTGCTTGGATGGCTGGTCGAAAAGGTC
TTCGATTTTGCAGGTCAATCCGGGTTGTACTTTCACTGGGGGCAGAACAAGGATCAGGTTGTCAGCCCGA
TGAGGCAAACTATTGCCAGTGAAGAAGACGACATTGAACCGTTATTCAGTGAAGAACAGGTGACTGAACA
TCTGCGTCTACGTTATGGACGCCGCTGGCAGCGTAAGGTGCGGATCCTGCTGGTCATGGGAAACAGAGAT
AACGTCCAGAAAGCTGCCCCGGGCCTGATTCACGATTTATGGCAGGAAGGCGACGGCGATGTACTGATTT
ATGGTGGTGATGCTCAGTCACTTTCTGATGATGTTTTCTTTTCGAAACTGAAACGTCTGCGTTCCGCTAA
CCCACTGGACGGCATCGTTCAAGTCATCAATAGCTTAGCGTTACCGGATGATATCGCGTGCGATGCCTTT
TTACGCTGCCGCCAGAAAGCCGATAACCTGCTTGGCTGGCAGGCGCCCGTATGGCTGTGGCTGACCGACG
AAGCGATCGGGCTGCAGGAAGGTCGTGCAGATGTCGCCACAGGGGTGATGTTCGGCCCGGGGGCAGCACC
GGGGGATATTAGCGCAACGCTCGATGCGCTGGTTCCACGTCTGCGTAGCGCTGGCATCGCTCAGCTACTG
GGCGATGCGCAGCATGACGGGTTTCTAAGCCTGTCCTCACGTTTGCATGGCGAATTAAAGGAGAGGTTAA
ACGTCCTGCTCGGCGCGTTGATGCAGGGTTCAGCGGCATATCGTCTGCGCGGCGTGGTGTTCAGCCCTGA
GCTGTCTGTCGCGGGTTCGGTACCCAATACCCGGCTCGATACCCCGACCTGGAAAGCGGTGATCGACGAC
TGTGATGCGGTGCGGCCTAAAAAACTCACCTTTGACTGTATCAGGGGACTGCGCTTAGCGCTGCTCACGC
TGATTACCCTGTGGGGAGCCGGTACCATGGTGTCGCTCGCCGTTAACCGGGCGCAAATTTATCAGGCACA
GGAAACGGCCCGTCTTGCCGCTGATACGAAACAGCCACTGACTGAGCGTCTGCGTAACCAGCTGGTGCTT
CAGCAGGCCATTGCGCGACTGCAAAACCGCGAGGCCAGCGGTGCCCCCTGGTATACCCGCTTTTGGCTTA
ATCAGGACGGCGACACGCTGACCGCGCTATGGCCGTTGTATGCCCGCAACAATGCACTGTTAATGCGCGA
TGCCACCACCGCACAGTTTACCCGGCAGCTCAATGCCTTCGTGCAACTTCCCCCGGCCAGCAGCGCCCGT
GCACAGGGCACGCAACGCACTTACGGCGTGCTGAAAAGCTACCTGATGATGGCCCGACCGGATAAAGCGG
AGGCCGGATGGCTGGCGAAAAATGTGCTGATGGCCTGGCCCAAACGCCACGGCGTGCCGGAGGGTAGCTG
GCAGGAGCTTGCCCCCAAATTATTGGGGTTCTATGCGCAAAACCTTCCGGCACATCCGGAATGGAAAATT
AAGCCCGATGCCGGACTGATCGGCAATGTGCGTCAAATCCTGCTCAAGCAGATTGGACAGCGTAACGCTG
AATCCGGGCTGTATCAGGACATGTTGAAGCGCGTTGCCAGCAACTGGCCCGACCTGACGCTGGCTGATAT
GACCGGCGACACTGATGCTTCCACGCTATTCCGTACCGAAGAGGTGGTGCCGGGGATGTTCACCCGTCAG
GCCTGGGAAGAGCAGGTTCAGGATGCGATCAATGAAATGGTGATAACCCGCCGTGATGAAATCGACTGGG
TGCTGACAGACAAATCCCTCCAGCCGGCCAGCGATGTGTCACCGGAAGCGCTGAAAACCCGTCTGATCGA
ACGCTATTTCACCGACTTCGGTAACGCCTGGCTGAATATGATCAACAGTATTCAGTGGCAGGAGGCCACC
TCGCTTTCGGAGGCTATTGCCCAGCTCAACCTGATAGGTGATGTTCGCCAGTCACCGCTGGTGGCATTAA
TGAACGCGCTCGGCTGGCAGGGTAAAACAGGGCAGAAAGGCGGGGCATTGGCGGATTCGATCGTGAATTC
AGCGAAAAAGCTGATCGGCAGCAAAACAAAACCGCAACAGTTTATTGAGCAGGGCCAAACGGCCAAAGGC
CCGCTGGATGGCCTGTTTGGCCCGTTATTGGGGGTGATGGAAGGCAAAGACAGCAGCGGCGGCAACGGCA
GCCTGAGCTTCCAGTCATGGCTTGCCCGCGTCACGCAGGTGCGTCTTAAGCTTCAGCAGGTGACCAGTGC
GCCAGACCCACAGGCAATGTCGCAAATGCTGGCTCAGACCGTGTTCCAGGGTAAAGCCACCGACCTGACC
GATACGCGTGATTACGGCAGCCTGCTGGCCGCCAGCCTTGGGCAGGAGTGGAGTGGCTTCGGGCAGTCGT
TATTTGTGCAGCCCCTGGACCTGGCGTGGCGGCAGGTGCTGGCCCCGGCGGCGGAAAGCCTCAACGCCCG
CTGGCAGAGCACGATCGTGGATCAATGGCACACAGCTTTTGCCGGTCGCTATCCGTTCAAGGTCACCGGC
AGCGATGCCTCTCTGCCTCTGCTGGCACAATTTCTGCGCAGTGACTCGGGCCGGATCACCAGGTTCCTGA
AAACTAACCTTGGCGGCATCCTGCATCAGGAGGGTAATCGTTGGGTAGTGGATCCCGCCGCAAGCCAGGG
GATGGTGGTGCACCCTGATTTTCTCCGGGCGATAAACCAGCTGGCAGAGTTATCAGATATCGTTTTTGCC
CAGGGGGATGCCGGGATCCACTTTGAGCTGATGGCGCGCCCTTCGCGAGATGTCGCGCGTATGCGGCTCA
CCCTTAATGAGCAGAATCTGGATTACTTCAACCAGATGGAAAGCTGGCAAAACTTCGCCTGGCCGGGGAA
TACGTATTACCCGGGGGCCAGCCTAAGCTGGCGCAGCGTGAATACGGGTATGCAGCTCTACGCCAGTAAC
CCGGGCAACTGGGGATTTATTCGTTTACTGGGCCATGCGCAAATCACGCCATTGGATGGCAGTCGAACAC
AATTGGTGTGGGCAGCCCCAGATGGCAATCCACTGAAATTTGTTATGCGCAGTGAACTGGGGGACGGTCC
GTTGGCATTGCTGAAACTTCAGGGGTTTACGTTACCAGAGTCCATTTTCAGCGTGGGTAAGGCCAGGAGG
CAGAAAGAATGA
 Primer design