SecReT6
Protein ID: 292898105
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0379
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]460188..463559 [+]
Productmembrane protein
NoteTssM
UniProt IDD4IE31
KEGG IDeay:EAM_0379
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-69, Aligned region: 420..731
DUF1215 [PF06744], Evalue: 1.40E-33, Aligned region: 853..973
Protein Sequence: 1123 a.a.     [Download]
>gi|292898105|ref|YP_003537474.1| membrane protein [Erwinia amylovora ATCC 49946]
MSKVKVKTLIGSVVTVAFFLTVIVGFVFYAFPANVASLTGVGPYDGLRIFAFCAALVAALILLGWLVEKV
FDFAGQSGLYFHWGQNKDQVVSPMRQTIASEEDDIEPLFSEEQVTEHLRLRYGRRWQRKVRILLVMGNRD
NVQKAAPGLIHDLWQEGDGDVLIYGGDAQSLSDDVFFSKLKRLRSANPLDGIVQVINSLALPDDIACDAF
LRCRQKADNLLGWQAPVWLWLTDEAIGLQEGRADVATGVMFGPGAAPGDISATLDALVPRLRSAGIAQLL
GDAQHDGFLSLSSRLHGELKERLNVLLGALMQGSAAYRLRGVVFSPELSVAGSVPNTRLDTPTWKAVIDD
CDAVRPKKLTFDCIRGLRLALLTLITLWGAGTMVSLAVNRAQIYQAQETARLAADTKQPLTERLRNQLVL
QQAIARLQNREASGAPWYTRFWLNQDGDTLTALWPLYARNNALLMRDATTAQFTRQLNAFVQLPPASSAR
AQGTQRTYGVLKSYLMMARPDKAEAGWLAKNVLMAWPKRHGVPEGSWQELAPKLLGFYAQNLPAHPEWKI
KPDAGLIGNVRQILLKQIGQRNAESGLYQDMLKRVASNWPDLTLADMTGDTDASTLFRTEEVVPGMFTRQ
AWEEQVQDAINEMVITRRDEIDWVLTDKSLQPASDVSPEALKTRLIERYFTDFGNAWLNMINSIQWQEAT
SLSEAIAQLNLIGDVRQSPLVALMNALGWQGKTGQKGGALADSIVNSAKKLIGSKTKPQQFIEQGQTAKG
PLDGLFGPLLGVMEGKDSSGGNGSLSFQSWLARVTQVRLKLQQVTSAPDPQAMSQMLAQTVFQGKATDLT
DTRDYGSLLAASLGQEWSGFGQSLFVQPLDLAWRQVLAPAAESLNARWQSTIVDQWHTAFAGRYPFKVTG
SDASLPLLAQFLRSDSGRITRFLKTNLGGILHQEGNRWVVDPAASQGMVVHPDFLRAINQLAELSDIVFA
QGDAGIHFELMARPSRDVARMRLTLNEQNLDYFNQMESWQNFAWPGNTYYPGASLSWRSVNTGMQLYASN
PGNWGFIRLLGHAQITPLDGSRTQLVWAAPDGNPLKFVMRSELGDGPLALLKLQGFTLPESIFSVGKARR
QKE
 
Nucleotide Sequence: 3372 bp     [Download]
>ref|NC_013971.1|:460188-463559 membrane protein [Erwinia amylovora ATCC 49946]
ATGTCTAAGGTAAAAGTCAAAACGCTCATTGGCTCCGTCGTCACTGTCGCCTTCTTCCTGACAGTCATCG
TTGGGTTTGTGTTTTATGCCTTTCCGGCAAATGTTGCTTCGTTAACCGGGGTTGGACCCTATGACGGTCT
ACGCATTTTCGCATTCTGTGCCGCGCTGGTGGCCGCGCTTATTCTGCTTGGATGGCTGGTCGAAAAGGTC
TTCGATTTTGCAGGTCAATCCGGGTTGTACTTTCACTGGGGGCAGAACAAGGATCAGGTTGTCAGCCCGA
TGAGGCAAACTATTGCCAGTGAAGAAGACGACATTGAACCGTTATTCAGTGAAGAACAGGTGACTGAACA
TCTGCGTCTACGTTATGGACGCCGCTGGCAGCGTAAGGTGCGGATCCTGCTGGTCATGGGAAACAGAGAT
AACGTCCAGAAAGCTGCCCCGGGCCTGATTCACGATTTATGGCAGGAAGGCGACGGCGATGTACTGATTT
ATGGTGGTGATGCTCAGTCACTTTCTGATGATGTTTTCTTTTCGAAACTGAAACGTCTGCGTTCCGCTAA
CCCACTGGACGGCATCGTTCAAGTCATCAATAGCTTAGCGTTACCGGATGATATCGCGTGCGATGCCTTT
TTACGCTGCCGCCAGAAAGCCGATAACCTGCTTGGCTGGCAGGCGCCCGTATGGCTGTGGCTGACCGACG
AAGCGATCGGGCTGCAGGAAGGTCGTGCAGATGTCGCCACAGGGGTGATGTTCGGCCCGGGGGCAGCACC
GGGGGATATTAGCGCAACGCTCGATGCGCTGGTTCCACGTCTGCGTAGCGCTGGCATCGCTCAGCTACTG
GGCGATGCGCAGCATGACGGGTTTCTAAGCCTGTCCTCACGTTTGCATGGCGAATTAAAGGAGAGGTTAA
ACGTCCTGCTCGGCGCGTTGATGCAGGGTTCAGCGGCATATCGTCTGCGCGGCGTGGTGTTCAGCCCTGA
GCTGTCTGTCGCGGGTTCGGTACCCAATACCCGGCTCGATACCCCGACCTGGAAAGCGGTGATCGACGAC
TGTGATGCGGTGCGGCCTAAAAAACTCACCTTTGACTGTATCAGGGGACTGCGCTTAGCGCTGCTCACGC
TGATTACCCTGTGGGGAGCCGGTACCATGGTGTCGCTCGCCGTTAACCGGGCGCAAATTTATCAGGCACA
GGAAACGGCCCGTCTTGCCGCTGATACGAAACAGCCACTGACTGAGCGTCTGCGTAACCAGCTGGTGCTT
CAGCAGGCCATTGCGCGACTGCAAAACCGCGAGGCCAGCGGTGCCCCCTGGTATACCCGCTTTTGGCTTA
ATCAGGACGGCGACACGCTGACCGCGCTATGGCCGTTGTATGCCCGCAACAATGCACTGTTAATGCGCGA
TGCCACCACCGCACAGTTTACCCGGCAGCTCAATGCCTTCGTGCAACTTCCCCCGGCCAGCAGCGCCCGT
GCACAGGGCACGCAACGCACTTACGGCGTGCTGAAAAGCTACCTGATGATGGCCCGACCGGATAAAGCGG
AGGCCGGATGGCTGGCGAAAAATGTGCTGATGGCCTGGCCCAAACGCCACGGCGTGCCGGAGGGTAGCTG
GCAGGAGCTTGCCCCCAAATTATTGGGGTTCTATGCGCAAAACCTTCCGGCACATCCGGAATGGAAAATT
AAGCCCGATGCCGGACTGATCGGCAATGTGCGTCAAATCCTGCTCAAGCAGATTGGACAGCGTAACGCTG
AATCCGGGCTGTATCAGGACATGTTGAAGCGCGTTGCCAGCAACTGGCCCGACCTGACGCTGGCTGATAT
GACCGGCGACACTGATGCTTCCACGCTATTCCGTACCGAAGAGGTGGTGCCGGGGATGTTCACCCGTCAG
GCCTGGGAAGAGCAGGTTCAGGATGCGATCAATGAAATGGTGATAACCCGCCGTGATGAAATCGACTGGG
TGCTGACAGACAAATCCCTCCAGCCGGCCAGCGATGTGTCACCGGAAGCGCTGAAAACCCGTCTGATCGA
ACGCTATTTCACCGACTTCGGTAACGCCTGGCTGAATATGATCAACAGTATTCAGTGGCAGGAGGCCACC
TCGCTTTCGGAGGCTATTGCCCAGCTCAACCTGATAGGTGATGTTCGCCAGTCACCGCTGGTGGCATTAA
TGAACGCGCTCGGCTGGCAGGGTAAAACAGGGCAGAAAGGCGGGGCATTGGCGGATTCGATCGTGAATTC
AGCGAAAAAGCTGATCGGCAGCAAAACAAAACCGCAACAGTTTATTGAGCAGGGCCAAACGGCCAAAGGC
CCGCTGGATGGCCTGTTTGGCCCGTTATTGGGGGTGATGGAAGGCAAAGACAGCAGCGGCGGCAACGGCA
GCCTGAGCTTCCAGTCATGGCTTGCCCGCGTCACGCAGGTGCGTCTTAAGCTTCAGCAGGTGACCAGTGC
GCCAGACCCACAGGCAATGTCGCAAATGCTGGCTCAGACCGTGTTCCAGGGTAAAGCCACCGACCTGACC
GATACGCGTGATTACGGCAGCCTGCTGGCCGCCAGCCTTGGGCAGGAGTGGAGTGGCTTCGGGCAGTCGT
TATTTGTGCAGCCCCTGGACCTGGCGTGGCGGCAGGTGCTGGCCCCGGCGGCGGAAAGCCTCAACGCCCG
CTGGCAGAGCACGATCGTGGATCAATGGCACACAGCTTTTGCCGGTCGCTATCCGTTCAAGGTCACCGGC
AGCGATGCCTCTCTGCCTCTGCTGGCACAATTTCTGCGCAGTGACTCGGGCCGGATCACCAGGTTCCTGA
AAACTAACCTTGGCGGCATCCTGCATCAGGAGGGTAATCGTTGGGTAGTGGATCCCGCCGCAAGCCAGGG
GATGGTGGTGCACCCTGATTTTCTCCGGGCGATAAACCAGCTGGCAGAGTTATCAGATATCGTTTTTGCC
CAGGGGGATGCCGGGATCCACTTTGAGCTGATGGCGCGCCCTTCGCGAGATGTCGCGCGTATGCGGCTCA
CCCTTAATGAGCAGAATCTGGATTACTTCAACCAGATGGAAAGCTGGCAAAACTTCGCCTGGCCGGGGAA
TACGTATTACCCGGGGGCCAGCCTAAGCTGGCGCAGCGTGAATACGGGTATGCAGCTCTACGCCAGTAAC
CCGGGCAACTGGGGATTTATTCGTTTACTGGGCCATGCGCAAATCACGCCATTGGATGGCAGTCGAACAC
AATTGGTGTGGGCAGCCCCAGATGGCAATCCACTGAAATTTGTTATGCGCAGTGAACTGGGGGACGGTCC
GTTGGCATTGCTGAAACTTCAGGGGTTTACGTTACCAGAGTCCATTTTCAGCGTGGGTAAGGCCAGGAGG
CAGAAAGAATGA
 Primer design