SecReT6
Protein ID: 294504688
SecReT6 ID393
T6SS typei3
Gene symbol-
Locus tagYPZ3_2578
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3324834..3328661 [-]
Producthypothetical protein
NoteTssM
UniProt IDD5B0L5
KEGG IDypz:YPZ3_2578
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.60E-84, Aligned region: 584..899
ImcF-related_N [PF14331], Evalue: 4.90E-72, Aligned region: 251..536
DUF1215 [PF06744], Evalue: 1.10E-29, Aligned region: 626..647
DUF1215 [PF06744], Evalue: 1.10E-29, Aligned region: 1014..1127
Protein Sequence: 1275 a.a.     [Download]
>gi|294504688|ref|YP_003568750.1| hypothetical protein YPZ3_2578 [Yersinia pestis Z176003]
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLLILGFWYGAPR
FVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHK
KAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFISNRWRTELPWFMVVGMKGAGKTALILSSGQ
DFPLPEQLNRIGKENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIV
AISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGV
TFPYNEAKEQSDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISD
VAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQAT
GAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFL
QKYLFPMVENQSEVTLRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKS
IFVGHLNTLFTLKDWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHAT
QVFTLSDDELLHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEI
NIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADVTGGNNLSVLQGTQMSRIIGT
LNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDM
GVGEICRNTLQGRYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAF
FEQAAMIRNVLFNTNDGKKMALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIV
SLTAQRQKASAMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLL
RDFKCPSVNDMNGIW
 
Nucleotide Sequence: 3828 bp     [Download]
>gi|294502110|ref|NC_014029.1|:c3328661-3324834 Yersinia pestis Z176003 chromosome, complete genome
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGCATATTGCTGGTCGGCTGCTTTATAT
TGCTGGCTGCGGCGATATGGTTTCTGGGGCCTTTCCTCGGCTTTGGTGAGGCGCGGCCTCTCGAAAGTTA
TGAAGCCAGAATTATTTGCATCCTGCTGGCACTGCTGCTGATCTTAGGTTTTTGGTACGGCGCACCGCGC
TTTGTCATTGCCGCCGTCGTTGCCTGTGCTGCGGTATGGGTGATTGGCCCATTCATATTAGTTGGTGATG
ATCATCCTCTGACTGATGGGATCCGTCGCGGCATCATTATCGCCATCATTGCATTTATTACACTTATTTA
TGGCACCTGGTGCTTAGTCAAAGCATTGGCGAAAAATCCAGCGTTACTGGATAACTTCATTAAGCACAAG
AAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCTGAAGTTAATGCGATGATCCGCAATGGCATGAACT
ATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGCGACGTTTCTTTATCTCCAACCGTTGGCGCACAGA
ACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGCAGGGAAAACCGCCCTTATCCTCTCTTCAGGACAG
GACTTTCCTTTACCTGAGCAGCTGAATCGTATTGGCAAAGAAAACCCACCCACTCAACATTGTGAATGTT
TGTTCTCTAATGACGCCCTGTTTTTAGACACTTCAGGGAAATACATTGATGACAGCAAAGATAATCAGAC
TGAGTGGACCGGGATATTAAAGGCACTCAAAAAATATCGTCCGGTTAAGGCAATTAATGGTGTCATTGTT
GCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAAGCTGATTTACTGAATGTGTCGGCGACGCTACGCA
CGCGTTTGGATGAGGTTCGTGCGGTCTTGGGCGTCCGTTTCCCGGTGTATGTCACGATTACAAAACTGGA
TCAAATATCGGGTTTTGATGAATATTTCCGTAATTTAACGGCTGAAGATCGCGAGCAAATTTGGGGGGTG
ACTTTCCCTTATAACGAGGCGAAAGAGCAATCCGATATGCCACTTCAGCAACGTATCAGCCATGAGCTGG
CACTGCTTGAGGATCGTATCAGCAATAATATGCACGTCCGCCAGCAGGAAGAGTATGCCGTGGCGGACAG
AAAAGGCATGTATGCACTCCCTCAGGATTTCAGGATGCTCTCCCAGAGGGTAACGGAAGTTTTACAGAAT
GTTTTCTTCGCCTCACGCTTTGACGAAACAAAATTTCACACGACCCTGAGAGGGATCTATTTTGTCAGCA
GTTGTCAGCCTGCGGATGTTGAACTGTTAAATAACAACACGCTGATTCAAAAGTGGCGTAACGTTATTAA
TCATAAAAAACCGTTATCGCCAGCCGATTTATCACAAAAAAGTGATAATGAAGATCGGTTTATTAGCGAT
GTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTGTTTAGCGATGTGATTACCAAAGATGCCGACTTAG
TCAGCTATAACCTGAAAGTACAATCCAAATACCGTTTTCAGAATCTATTGGGACACGCGGCTTGTATTGG
GTTGGCAGTTTGGCTGGTTTGGGCCTTCTTGGTCAGCTTCCAGCATAACGAGGGGTATTTACAGGCGACC
GGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATGAGTTATGCCAAAACGTCCAATGAGCAGATCTTAC
CTGCGTTATTGAACGCGACACAGCAGTTACCCGAGTACGGTACGCTGGATGTGGCTAACCCTGAGCTTGA
CTGGCGTTATGGCTTATATACCGGTAGCGCAATCTCACAAGGTGCGAACACGCTCTATCAGTTTTTCTTG
CAAAAATATCTCTTCCCAATGGTTGAGAATCAGAGTGAGGTTACATTAAGAAAAACGATGCACTCAGGTC
AGAGCGAAGAGGTTTATGCCGCGCTGAAGCTTTATTTGATGCTGACGGGTGAAGGTAAATTTGATCGTCA
ATATATGATTGAGCACGTGACCCAAGATTGGCAGAAAAGTGGAAAAATTGAGCCTTACGAAGAGAAGAGT
ATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTGAAAGACTGGCGGCAGTATGGGCAACCGGCAGACA
GTGAACTGATTAAGCAGGCTCGGGCAATACTGGCGGAAAAAACAGTGACCGCCAGACTTTGGGGGCGTAT
TCAATCCCGCTTATTGGCCGATGCCCCTGCCAATATGACGTTACGTAAAATGGTGGGTGAGCACGCGACA
CAGGTATTCACCCTGTCAGATGATGAACTACTGCATGAAGGGATCCCGGGGCTTTATACCTACGCGGGCT
ACCATGAGGTGGTTAAAAAAAAACTGACACCTTTGCTGATGTTACTTCAGGAAGAGGATAGGTGGGTGAT
GGCGCAATCGCTGTCATCTTCTCTTGACCCCCTGACGTTAAGACAAGATGTTCTGGTGATGTATTTACAA
GGGTATGCCGCTTATTGGAAACGCTTTCTCTCCAGTGTTCGTCTGATTTCTGTCGATGCGGACAGTGCAG
AGTATGCTCAAGGGCTGTCTCTGGATATTGCTTTGTTAAGGACGTTAGTTTCAGAAAATTCACCGCTACT
CAATTTAGCCAGGCAGGCGGTAAAAGAAACGACACTCGCCGAAAAAGAAAAAGCCATTACTGATGAGATA
AACATCAGAACGCAAGGGCAATTACTCAGCCAGGCTAAAAAATTACAAGAAACGATCGCGTTTCGTGAAA
ATAAACTGATTAAAGAGTGGGTTGATAATCGTTTTGAATCCCTGAGAGTCTTTGTTAATGGGGAACAGAG
TGCTGATGTCACGGGGGGCAATAATCTTTCTGTTCTTCAGGGAACGCAGATGAGCCGAATAATCGGGACA
TTAAACGATCAATATACCCGTTTTGTTGTTTATAACAGTGCCTTTGAATATGGCGATATTCCTCCGTTAT
CCCAGGATGGGGAACGTATTGCGGTGGAATCACAAACATGGCCGGATCCGTTTAGAAATATTATTGCACC
GTTATTAACGGGCTCATCCCAGAAATTTGAAAATAAAGTGATTACTCACACGTCCAAAGCGATTGATATG
GGGGTGGGGGAAATTTGCCGGAATACGCTGCAAGGGCGTTACCCATTTGCTGAAAGTGAGCAAATTGTTA
GTTTGAATGATTTTGAGCGTTTCTTCGGTACTGACGGTACGGTGGACAGTTATTTCAAGAAAAACTTGGA
GAGTAAAGTCGACACGTCCTCAATACCTTGGCGTTATAAGGGCAGCGTAAGTAGTGAAGGTTTGGCGTTC
TTTGAACAGGCGGCAATGATCAGAAACGTGCTATTTAATACCAATGACGGTAAAAAAATGGCATTAGATT
TTTCCGTATCAGTGCGTTATTTAGCACCCACTATCACCCAACTTATTATGAACTTTGATGGTAATACTGT
GCGTTATTCCCATGGTCCCGTAACGCCAGCCTTCTTTAAATGGCCGGGTTTACGTCAAGGCACCATTGTC
AGTTTAACGGCCCAACGCCAGAAGGCATCCGCGATGCCCGATATTCTTTTTCGCGGACCTTGGGCACTCT
TGCAGTGGGCTGATCAGGCCGATGAAATTCGCGATGAAGCGAATGGCAAACAGACGCTGACTTATCTCAT
GGGGAAAGATCGTGTCGAGCTTGAAGTCTCAGGTTTAACGCATGGTGGTGAAACCATTAGCGATCTGCTG
AGAGATTTCAAATGCCCCAGTGTCAATGACATGAATGGTATTTGGTAA
 Primer design