SecReT6
Protein ID: 295681045
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6248
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]709366..713331 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDD5WLL2
KEGG IDbge:BC1002_6248
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.00E-90, Aligned region: 603..920
ImcF-related_N [PF14331], Evalue: 3.40E-90, Aligned region: 274..554
DUF1215 [PF06744], Evalue: 3.50E-30, Aligned region: 1039..1160
Protein Sequence: 1321 a.a.     [Download]
>gi|295681045|ref|YP_003609619.1| type VI secretion protein IcmF [Burkholderia sp. CCGE1002]
MSYLNRLSKLVLTRQTLMLAAILVAAAAVWFVGPLIAFGDYRPLDSVLSRTLSVVVLLLLLLFWLLGWSP
GVIGVALLCVALWYFGPILAFGETHPLGTTWSRVLLISVLLACYAIYELYRLWRAVRSDDVLLQRVLNPF
TKKSAATPVARDEIRALHAIVAKAIDKLKRMRGGSAGLRRLLESQRYLYELPWYMVVGSPGAGKTTLILN
SGLDFPEAEQMAAASLGSRIETENCDWWFANEAVLIDTAGRYMVQDAASHDAAQVDVKPEDLKSANEAEW
RGFLGLLRKRRPRAPINGALLAVSVEELLTRPASERKALAASMRARLGELRQQLGIRFPVYVVVTKLDLL
PGFGEYFQSLTAESRAQIFGFTLPYQEEPEQHGRDTLRLTCAAEMRELEQGLEDGINTRLQEVYEVDLRK
KLYALPAEFRSLCAELNELLALVFLDSKYDDTQLNSTLRGVYFTSAAQTHEAVSADSTTLLQRLRRGLAG
LFGAAPKTVSPSSGDATPTAYRGYFLRNLFQRVILAEAHLVRPNLYWEIRFRALRLVGHLLAIIIVVWLM
GALVVSFGNNREYLAAIDGKANGLAARVSSQRKAPRAGAMGSILSASRDLPQFDGIDLDSPGLAWRYGLY
TVPAISAAAGETYDGLLKQMLLPQVIGRLETVLDTQIGAQAADGVYRTLTVYLMLFDRSQYDAKAIKAWV
LGDWEHNNSVAPLGERSVMARHLDALLGEGVPAVPAKPVNAQLVRRAREFLGRNPASGRLYERAMNAMAP
EAPENVTLLSAAGPQATTVFMLADGSTLARGIPGLYTYDGYHAVFNQRLPEFLERARKQDAWVMGEADAS
ARWRQMANGNALRKDRLADDIRRQYLTDYANYWSQFLDDVRPVSGSDGTLAPDLQTLRTLAAPDSPLARL
ARTAARETSLSVADGADEPSAAGSAINVITRRSQVARAASAVAATATIGQLAQRKMERELVDRRFAALRE
VVTGQADSGSALPGGSGVLQLGGVIGLINEQYTRLMTAGDVLATNSMPPTDDLGSTMQFEAQKLPPPFRA
VLVGLASQSIRKVDRNVGSLLTMQVESSVGAQCRRAVEGKYPFVASVQEVDIDDFNRVFAAGGLLDDFFH
KTLASRVDTSIRPWRYKPVSPGMPPMQGPSLDPFERAAAIRQTFFRDPSATRMSWNAGLKVVSLDPEITD
LLIDVDGQNLRYAHGPVATFPITWPGPRGGSMAGLTANPRVRPDTSTVMTAGPWALFRLIDRGLVTSTLS
SSRSAVDFNFDDRHAVIELTSGGQSGPQLTALLRGFRCPGSGSALARRAEASSGSASADEL
 
Nucleotide Sequence: 3966 bp     [Download]
>gi|295680425|ref|NC_014119.1|:c713331-709366 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGTCTTATTTGAACCGCTTATCGAAACTTGTGCTGACGCGCCAGACGCTGATGCTCGCCGCGATCCTCG
TGGCGGCTGCGGCCGTCTGGTTCGTGGGGCCTCTGATCGCATTTGGCGACTACCGGCCGCTCGACAGCGT
GCTCTCGCGCACGCTGTCAGTCGTCGTGCTGTTGTTGCTGCTGCTGTTCTGGCTGCTCGGCTGGTCGCCG
GGTGTCATCGGCGTCGCGTTGCTGTGTGTCGCGCTCTGGTATTTCGGACCGATACTCGCGTTCGGCGAAA
CGCATCCGCTCGGCACCACATGGTCCCGCGTGCTGCTGATCTCGGTGCTGCTCGCCTGCTATGCAATCTA
TGAGCTGTACCGCCTGTGGCGGGCAGTGCGCAGCGACGACGTGCTGCTGCAGCGCGTCCTGAATCCGTTC
ACGAAGAAGTCGGCAGCGACCCCTGTTGCACGAGACGAAATCCGCGCGCTTCACGCGATCGTCGCGAAGG
CCATCGACAAGCTCAAACGCATGCGCGGCGGGTCGGCGGGGCTGCGTCGCCTGCTCGAAAGCCAGCGCTA
TCTGTACGAACTTCCGTGGTACATGGTCGTGGGCTCGCCGGGTGCGGGCAAGACGACGTTGATCCTGAAT
TCGGGTCTGGATTTTCCGGAGGCGGAGCAGATGGCCGCGGCGTCGCTTGGAAGCCGCATCGAAACGGAGA
ATTGCGACTGGTGGTTCGCGAACGAGGCGGTGCTGATCGATACCGCTGGCCGTTATATGGTTCAGGACGC
AGCATCGCATGACGCCGCGCAGGTCGACGTCAAACCGGAAGACCTGAAGAGCGCGAACGAGGCCGAATGG
CGCGGCTTTCTCGGGCTGCTTCGCAAGCGGCGACCGCGCGCGCCGATCAACGGTGCGTTGCTGGCCGTTT
CGGTCGAAGAGTTGTTGACGCGCCCAGCGTCCGAACGAAAGGCGCTCGCCGCGTCGATGCGCGCGCGGCT
TGGCGAGTTGCGCCAGCAGTTGGGGATTCGATTCCCGGTTTACGTAGTCGTCACGAAGCTCGATCTGCTG
CCCGGCTTCGGGGAGTATTTCCAGTCGTTGACGGCGGAAAGTCGCGCGCAGATTTTCGGCTTTACACTGC
CCTATCAGGAAGAGCCGGAACAACACGGCCGCGACACACTGCGCCTGACCTGCGCGGCCGAGATGCGTGA
GCTGGAGCAGGGACTCGAAGACGGCATCAACACCAGGCTGCAAGAGGTGTACGAGGTCGATCTGCGCAAG
AAGCTTTATGCGCTGCCGGCCGAGTTTCGCAGCCTGTGCGCGGAACTCAATGAATTGCTCGCGCTGGTGT
TTCTCGATTCGAAATACGACGACACGCAGTTGAACAGCACATTGCGCGGCGTCTATTTCACGAGCGCGGC
GCAGACTCACGAGGCCGTGTCCGCCGACAGCACCACACTGTTGCAGCGGCTGCGCCGCGGGCTCGCGGGT
TTGTTCGGCGCCGCGCCGAAAACCGTCTCGCCGTCGTCCGGCGACGCTACGCCTACCGCCTATCGCGGCT
ACTTCTTGCGCAATCTGTTTCAGCGCGTGATCCTGGCCGAAGCGCATCTGGTGCGGCCGAACCTGTACTG
GGAAATCCGCTTCCGCGCGTTGCGTCTGGTCGGGCATCTGCTCGCGATCATCATCGTGGTGTGGCTGATG
GGTGCGCTGGTCGTGAGCTTCGGCAATAACCGCGAGTATCTTGCTGCGATCGACGGCAAGGCCAATGGGC
TCGCCGCTCGGGTCTCGTCGCAACGCAAGGCGCCGCGGGCCGGGGCGATGGGGTCGATACTTTCAGCGTC
GCGTGACCTGCCGCAGTTCGACGGCATCGACCTCGACAGTCCCGGTCTCGCATGGCGCTACGGGCTGTAC
ACGGTGCCCGCCATCAGCGCCGCCGCCGGCGAGACCTACGACGGTCTGCTGAAGCAGATGCTGCTGCCGC
AAGTCATCGGCCGGCTCGAAACGGTGCTCGATACGCAAATCGGCGCACAGGCCGCGGACGGCGTTTATCG
CACGCTGACGGTCTACCTGATGCTGTTCGATCGCTCGCAATACGACGCGAAAGCAATCAAGGCATGGGTG
CTCGGCGACTGGGAGCACAACAACAGCGTCGCACCGCTCGGCGAGCGCAGCGTGATGGCGCGACACCTCG
ACGCGCTGCTCGGAGAAGGGGTCCCCGCGGTGCCGGCAAAACCGGTGAATGCGCAGCTGGTGCGTCGCGC
GCGCGAGTTCCTTGGCCGCAATCCGGCGTCCGGACGGCTCTACGAACGTGCGATGAACGCCATGGCGCCG
GAGGCGCCCGAGAACGTCACGCTGCTGAGCGCCGCGGGTCCGCAGGCCACTACCGTGTTCATGCTGGCCG
ACGGCTCGACGCTTGCGCGAGGCATCCCCGGTCTCTATACCTACGACGGCTATCACGCGGTATTCAACCA
GCGCCTGCCCGAATTTCTCGAGCGGGCGCGCAAACAGGACGCGTGGGTGATGGGCGAGGCCGATGCATCG
GCGCGGTGGCGGCAGATGGCCAACGGCAACGCACTGCGCAAGGACAGGCTCGCCGACGATATCCGTCGCC
AGTACCTGACCGACTATGCCAACTACTGGAGCCAGTTTCTCGACGACGTGAGGCCGGTGTCCGGCAGCGA
CGGCACGCTGGCGCCCGATCTGCAGACGCTGCGCACACTGGCCGCGCCGGATTCGCCATTGGCGAGACTC
GCGCGAACGGCCGCGCGCGAGACGTCGCTGTCAGTCGCTGACGGCGCGGACGAGCCGTCGGCCGCGGGGA
GTGCCATCAACGTGATCACCCGTCGCTCGCAGGTAGCGCGCGCCGCGAGCGCCGTGGCGGCAACCGCTAC
CATCGGTCAGCTTGCGCAGCGGAAGATGGAACGTGAACTGGTCGACAGACGCTTTGCCGCGCTGCGCGAA
GTCGTGACCGGCCAGGCCGATAGCGGCAGCGCGCTGCCTGGCGGCAGCGGCGTGCTGCAGCTGGGCGGCG
TCATCGGGCTGATCAACGAGCAGTACACGCGATTGATGACGGCCGGCGACGTGCTCGCCACCAACAGCAT
GCCGCCCACGGACGACCTCGGCTCCACGATGCAGTTCGAGGCGCAGAAGCTTCCGCCGCCGTTTCGGGCC
GTGCTCGTGGGCCTCGCGTCGCAGTCGATACGCAAGGTGGACCGCAACGTCGGCTCGCTGCTGACGATGC
AGGTCGAATCGAGCGTTGGCGCGCAATGCCGCCGCGCTGTCGAAGGCAAATATCCGTTCGTCGCGAGCGT
CCAGGAAGTCGACATCGACGATTTCAACCGCGTGTTCGCGGCAGGCGGCCTGCTCGACGACTTCTTCCAC
AAGACGCTCGCGAGCCGTGTCGATACGAGCATACGGCCGTGGCGCTATAAGCCGGTCAGCCCCGGCATGC
CGCCCATGCAGGGACCGAGCCTCGATCCGTTCGAGCGCGCCGCGGCGATCCGCCAGACATTTTTCCGCGA
TCCGAGCGCAACCCGGATGTCGTGGAACGCGGGCCTGAAGGTCGTGTCGTTGGACCCAGAGATTACCGAT
CTGCTCATCGACGTCGACGGGCAAAACCTGCGCTATGCGCACGGGCCGGTCGCGACATTCCCGATCACAT
GGCCGGGGCCGCGCGGTGGCTCGATGGCCGGCCTCACCGCGAATCCGCGCGTGCGTCCGGACACGTCGAC
CGTGATGACCGCAGGTCCGTGGGCGCTGTTCCGTCTGATCGACCGGGGGCTTGTGACGTCGACGTTGTCG
TCGAGCCGCTCGGCAGTGGACTTCAATTTCGACGACCGGCACGCGGTGATCGAACTGACGTCGGGCGGAC
AGTCGGGACCGCAACTGACGGCGTTGCTGCGGGGTTTTCGTTGTCCTGGCAGTGGAAGCGCGCTGGCAAG
GCGAGCGGAAGCGTCGTCAGGCTCCGCATCCGCCGACGAGCTGTAG
 Primer design