SecReT6
Protein ID: 295699886
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4281
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1172998..1176582 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDD5WIH3
KEGG IDbge:BC1002_4281
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.30E-71, Aligned region: 429..754
DUF1215 [PF06744], Evalue: 5.60E-32, Aligned region: 894..1008
Protein Sequence: 1194 a.a.     [Download]
>gi|295699886|ref|YP_003607779.1| ImcF domain-containing protein [Burkholderia sp. CCGE1002]
MNEHKSEPVALFIGIGICILFVALGLTVWVEGPAHGWTQETRIIIELCLLSGMLIALMLVKYFEAVVLWI
ASMRATQWFARYDSKNKRARGANEDPALAHFTAPENIVALREALHALHGRHWRYRDRWLLLTGDLRLVKR
LAPGLAESGYAITGNTVLLYAAQTGATLDTTWLTQIRRLRRRRPIDAIVAITRNRTSANSNFDADALAQR
LARHARALRWSAPAYLLDVTDFSTEPKGDDEAIGLTWSNARVHSANIDDSLQNLTRRLADTGVLRLGHDK
HDRYPAELSQHIERLSSVLSGLVAQTAHSKNWRQAVHGLLFAPLFKERELAPPATPDDDKDSGGEDAEAK
RIAPQHRTLWQTIADHSRKLHGRRIGFCLSTAAAWTVTAAIALWITGTMISGVANRTTIHSAADTLTKLA
EEHHPSQSMQTLDTLDKQIDTLESHQRDGAPHLARFGLNRDAALLDALWPRYENAAGRILVGPIREQMEA
RLHRLASLTDAEIASGGSGEVRAAYDTLKTYMMLARPERAVAAFLAPQLTAASAPARPANSPLSAGAWED
LRQHTIAFFANHRGRHASTSGSSFAIVADNGLISATRQTIIGVRGIQNSTDAVYQQILDDAKAKYPPVPL
ATLLGDTSSRGLFSTTATVPGVFTRAAWEERIAKAIDDASEQSKVTGDWVLSDVENKTELPSSLKAELRQ
RYFDDYARAWGLFLNSLRWQSAPTLSATADQLTLLGDPQRSPLVMLMNAIVYQAGTGARTPSLSDTLVSK
AQQLVGADQKNPSKQTQPPLAPLAVAFGPILRLAGSDLASSATRANAKSAAQLAATGDLSVARYLERVTA
MRLKIEQIVSSPDTDAMSRIAAQAVLQGKTSDIADSRDHASRLAASLGERWAGFGALFQAPLDQTWRVLV
QPAAASLNEIWRTAIVADWNSAFGGRYPFADSDNDASLPEMARFMRPDNGVITQFVTTQLAGVVERQGDR
WIAAQGTSHGRALTLDPAFLDGLNEMTRASTVLFPFGDAHVRYELRPVPTPGVTDMRFMLSGRELHYFNQ
KEEWTPFLWPGDSLENLSHIEWQTEHGGLRSALDAQGRFGLIRLIERAQVSQQDAARYLLSWQPDQGEGI
SLRVQLRSEAGSGPLEVLSLRHFKLPGRIFVTGNAKSAPKPSEANPPPPLPPAALNAAKNAAVGLPQGLL
PEVE
 
Nucleotide Sequence: 3585 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1176582-1172998 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGAATGAACACAAATCTGAACCCGTAGCCCTTTTTATCGGCATCGGCATTTGCATTCTATTCGTTGCGC
TTGGTCTGACCGTCTGGGTAGAAGGTCCGGCGCACGGATGGACGCAAGAGACACGAATCATTATCGAATT
GTGCCTGCTCTCGGGCATGCTCATCGCGCTGATGCTCGTGAAGTACTTCGAGGCCGTCGTGCTCTGGATC
GCATCGATGCGTGCGACGCAGTGGTTCGCCCGCTACGATTCGAAAAATAAGCGAGCACGAGGCGCGAACG
AAGACCCGGCATTAGCGCATTTCACTGCACCGGAAAATATCGTTGCGTTGCGCGAAGCGCTCCACGCCCT
CCACGGCCGCCACTGGCGCTACCGCGACCGCTGGCTCCTGCTAACCGGCGACCTCCGCCTGGTAAAACGC
CTCGCCCCCGGCCTGGCCGAATCCGGCTACGCCATCACCGGCAACACAGTCCTGCTCTACGCAGCTCAAA
CCGGCGCGACCCTCGATACCACCTGGCTCACCCAAATCCGCCGCCTGCGCCGCCGCCGGCCAATCGACGC
AATCGTCGCAATAACCCGCAACCGCACCTCAGCCAACTCCAACTTCGACGCCGACGCGCTCGCCCAACGC
CTCGCGCGCCACGCGCGTGCACTGCGCTGGTCCGCGCCTGCCTATCTGCTCGACGTAACGGACTTCAGCA
CCGAACCGAAGGGCGACGACGAAGCGATCGGCCTAACGTGGTCGAACGCCCGAGTGCACTCGGCCAACAT
CGACGACTCGCTACAAAACCTCACCCGCCGCCTCGCGGACACCGGCGTCCTTCGCCTCGGCCACGACAAG
CACGATCGCTATCCGGCGGAGTTGTCGCAACATATCGAAAGGCTTTCCAGCGTGTTGTCGGGACTGGTCG
CGCAGACCGCGCATTCAAAAAACTGGCGCCAGGCCGTTCACGGCCTTCTGTTCGCGCCGCTCTTCAAGGA
GCGCGAACTCGCCCCGCCCGCGACCCCTGACGACGACAAAGACAGCGGAGGTGAAGACGCCGAGGCGAAG
CGCATCGCCCCCCAACACCGCACCCTTTGGCAAACCATCGCCGACCACAGTCGCAAGCTCCACGGCCGTC
GCATCGGCTTCTGCCTATCGACCGCCGCCGCGTGGACGGTCACAGCGGCGATCGCGCTATGGATTACCGG
CACGATGATCTCGGGTGTCGCGAACCGCACAACGATCCATTCCGCCGCCGACACGCTAACAAAGCTCGCG
GAAGAACACCACCCGAGCCAATCGATGCAAACGCTCGACACACTCGACAAGCAGATCGACACCCTCGAAT
CCCATCAGCGTGACGGAGCCCCGCACCTCGCACGCTTCGGCCTGAACCGCGACGCCGCGTTGCTCGACGC
CCTATGGCCCCGCTATGAAAACGCCGCCGGCCGCATTCTCGTCGGCCCGATCCGCGAGCAGATGGAGGCG
CGGCTGCATCGGCTTGCGTCACTGACCGACGCCGAGATTGCAAGCGGCGGCAGTGGCGAAGTGCGGGCCG
CCTACGACACGCTGAAGACATACATGATGCTCGCCAGGCCCGAACGCGCGGTCGCGGCCTTCCTCGCACC
GCAACTCACCGCGGCGTCCGCACCCGCGCGTCCCGCCAACTCGCCGCTGTCGGCCGGCGCATGGGAGGAC
CTGCGTCAGCACACCATCGCCTTCTTCGCGAATCATCGAGGCCGACATGCATCGACAAGCGGCTCGTCGT
TCGCGATCGTCGCTGACAACGGACTCATCTCGGCGACACGCCAAACGATCATCGGCGTGCGTGGCATCCA
GAACTCGACCGACGCGGTCTATCAGCAGATCCTCGACGACGCCAAAGCCAAATACCCGCCCGTGCCGCTC
GCGACGCTGCTCGGCGACACATCGAGCCGTGGTCTGTTCAGCACGACGGCCACGGTCCCCGGCGTCTTCA
CGCGCGCCGCGTGGGAGGAGCGCATCGCAAAAGCGATCGACGACGCGAGCGAGCAGAGCAAGGTCACAGG
CGACTGGGTGCTGTCCGACGTCGAGAACAAAACCGAGCTGCCGTCGTCGCTGAAAGCCGAGCTGCGTCAA
CGCTATTTCGACGACTACGCGCGCGCATGGGGGCTGTTCCTGAACAGCCTGCGCTGGCAATCGGCACCGA
CGCTGTCCGCTACCGCCGATCAACTAACGCTGCTCGGCGACCCACAGCGCTCGCCGCTCGTGATGCTGAT
GAACGCGATCGTCTATCAGGCGGGCACGGGCGCGCGCACGCCATCGCTGTCGGACACGCTGGTCAGCAAA
GCGCAGCAACTGGTCGGCGCAGACCAAAAGAATCCGTCGAAGCAAACGCAGCCGCCGCTTGCACCGCTCG
CAGTCGCGTTCGGGCCAATCCTGCGGCTTGCCGGAAGCGATCTCGCGTCCAGCGCCACGCGGGCGAACGC
AAAGTCCGCCGCGCAACTGGCCGCGACCGGCGACCTTAGCGTCGCGCGTTATCTCGAACGCGTGACCGCG
ATGCGTCTGAAGATCGAGCAGATCGTGTCGAGTCCCGACACCGACGCGATGTCGCGCATCGCCGCGCAGG
CGGTGCTGCAGGGCAAGACCTCGGATATCGCCGACAGCCGCGATCACGCGAGCCGTCTTGCCGCGAGTCT
CGGCGAACGGTGGGCCGGCTTCGGCGCGCTGTTCCAGGCGCCGCTCGATCAAACCTGGCGGGTGCTGGTG
CAGCCCGCCGCGGCGAGCCTCAACGAAATCTGGCGCACGGCGATCGTCGCTGACTGGAACAGCGCGTTCG
GCGGCCGCTATCCGTTCGCGGACTCCGACAACGACGCGTCGCTGCCGGAAATGGCGCGCTTCATGCGCCC
CGACAACGGCGTGATTACGCAGTTCGTCACAACGCAACTGGCGGGTGTGGTCGAACGACAGGGCGATCGC
TGGATCGCCGCGCAGGGTACGAGCCACGGCCGCGCATTGACGCTCGATCCGGCGTTCCTCGACGGACTGA
ACGAAATGACCCGTGCATCGACGGTGCTGTTCCCCTTCGGCGACGCCCACGTGCGCTACGAATTGCGCCC
GGTGCCGACGCCGGGCGTCACCGACATGCGCTTCATGCTGTCGGGCCGCGAGCTGCATTACTTCAATCAG
AAGGAAGAGTGGACGCCCTTCCTGTGGCCGGGCGATTCGCTCGAAAACCTGTCGCATATCGAATGGCAGA
CCGAGCACGGCGGCCTGCGCTCGGCACTCGACGCCCAAGGCCGCTTTGGCCTGATCCGTCTAATCGAACG
CGCGCAGGTGTCGCAACAGGACGCCGCGCGCTATCTGCTGTCGTGGCAGCCCGACCAGGGCGAGGGCATC
TCATTGCGCGTGCAACTGCGCAGCGAGGCAGGCTCGGGCCCGCTCGAAGTGCTCTCGCTGCGTCACTTCA
AGCTACCCGGCCGAATCTTCGTAACCGGCAACGCAAAGAGCGCGCCGAAGCCATCCGAGGCCAACCCGCC
ACCACCACTGCCGCCCGCGGCGCTGAACGCGGCGAAAAACGCGGCCGTCGGTCTGCCGCAAGGCTTGCTA
CCGGAGGTCGAATAA
 Primer design