SecReT6
Protein ID: 295700990
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5444
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2453895..2454431 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDD5WFZ6
KEGG IDbge:BC1002_5444
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.70E-55, Aligned region: 10..163
Protein Sequence: 178 a.a.     [Download]
>gi|295700990|ref|YP_003608883.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MSNSLQKWVGRNRPPRVQITYDVEVGDAVEKRELPLVVGLLADLSGHPATPLPKLKERRLVDIDRDNFDE
IMGKIRPRLDLSVPDTMKGEGNIKVELKFEKFEDFHPESIVNQVPRLAKLLEARQQLRDLLAKLDGNDEL
DSMLERIVQSSEELKKVQSQAQASNAPAAEAAGDAPAE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2453895-2454431 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGTCGAACAGTTTGCAGAAATGGGTGGGGCGTAACCGTCCGCCGCGTGTCCAGATCACCTACGACGTCG
AAGTCGGCGATGCGGTCGAGAAGCGTGAGCTTCCGCTCGTGGTCGGCCTGCTGGCGGACCTTTCGGGGCA
TCCGGCCACGCCGCTGCCCAAGCTCAAGGAGCGCCGTCTGGTCGATATCGACCGTGACAACTTCGACGAG
ATCATGGGCAAAATCCGCCCGCGACTCGACCTTTCCGTGCCGGACACGATGAAGGGCGAAGGCAATATCA
AGGTCGAGTTGAAGTTCGAAAAGTTCGAGGACTTCCACCCGGAAAGCATCGTGAATCAGGTGCCGCGCCT
TGCGAAGCTGCTCGAAGCGCGTCAGCAACTGCGTGATCTGCTCGCCAAACTCGACGGCAACGACGAACTC
GATTCGATGCTCGAGCGCATCGTGCAGAGCAGCGAAGAACTCAAGAAAGTTCAAAGCCAGGCTCAAGCCA
GCAACGCACCCGCGGCCGAGGCTGCAGGTGACGCACCGGCTGAATAA
 Primer design