SecReT6
Protein ID: 295700991
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5445
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2454514..2456022 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDD5WFZ7
KEGG IDbge:BC1002_5445
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.80E-179, Aligned region: 75..498
Protein Sequence: 502 a.a.     [Download]
>gi|295700991|ref|YP_003608884.1| type VI secretion protein EvpB [Burkholderia sp. CCGE1002]
MESTNAAGAAGSEAQTLDASAGAELSLLERIVHEGNMAVEPSQSGYAKQLIGQLASQILDEGMRTSPDKS
VVAMINERVAEIDKLLSDQLNAIMHDEAFQTLEASWTGLHDMVYGTETGPRLKLRLLNVTKKDLLKDLET
AVDHDMSALFKKVYEEEYGTFGGHPFSMLIGDYSFGRHPQDIALLERISKVAAAAHAPFIAAAAPSLFDL
KSFTDLGVTRDLSKTFESAELAGWRSFRDSEDSRYVSLVLPSYAARLPYGAKTKPVENFNFEEDVDGSDH
SKYLWANSAYQLGLRITDAFAKYSWATSIRGVEGGGKVENMVAHAYKTDEGDVVLKCPTEVTITDRREKE
LNDLGFIALVNSKGSNFATFFGGQTTNRPKLYNKDAANANSQLSARLPYVLAASRFAHYLKVMMRDKVGS
FQSRGDVEAYLNNWIADYVLINPSASHEQKARFPLGEARVDVTEVQGKPGAYRATCFLKPHFQMEELTAS
IRLVAELPAAAA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2454514-2456022 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGAAAGCACTAATGCAGCCGGCGCAGCCGGTAGCGAAGCCCAGACCCTCGACGCCTCGGCAGGCGCCG
AGCTGAGTCTGCTCGAGCGCATCGTTCACGAAGGCAACATGGCCGTCGAGCCCTCGCAGAGCGGCTACGC
GAAGCAACTGATCGGCCAGCTCGCGTCACAGATCCTCGACGAAGGCATGCGCACGAGCCCGGACAAGAGC
GTCGTCGCGATGATCAATGAGCGCGTCGCCGAGATCGACAAGCTGCTCTCGGATCAGCTCAACGCGATCA
TGCACGACGAAGCGTTCCAGACGCTCGAAGCGTCGTGGACCGGCCTGCACGACATGGTCTATGGCACGGA
AACGGGCCCGCGCCTGAAGCTGCGTCTCCTGAACGTGACGAAGAAGGACCTGCTCAAGGACCTCGAAACC
GCAGTCGATCACGACATGAGCGCGCTGTTCAAGAAGGTCTACGAAGAGGAATACGGCACGTTCGGTGGCC
ATCCGTTCTCGATGCTGATTGGCGACTATTCGTTCGGTCGTCATCCGCAGGACATCGCCCTGCTGGAGCG
CATCTCGAAGGTAGCCGCTGCGGCGCATGCCCCGTTCATTGCGGCGGCGGCCCCGAGCCTGTTCGACCTG
AAGTCGTTCACGGACCTCGGTGTGACGCGCGACCTCTCGAAGACCTTTGAAAGTGCCGAACTTGCCGGCT
GGCGCTCCTTCCGCGACTCGGAAGATTCGCGCTATGTGTCGCTCGTGCTGCCTTCGTACGCTGCGCGCCT
GCCGTATGGCGCGAAGACGAAACCCGTCGAGAACTTCAACTTCGAAGAAGATGTCGACGGCAGCGATCAC
AGCAAGTACCTGTGGGCCAACTCCGCCTATCAGCTCGGCCTGCGCATTACCGACGCATTCGCGAAGTACA
GCTGGGCGACCTCCATTCGCGGCGTCGAAGGCGGCGGCAAGGTGGAGAACATGGTCGCGCACGCGTACAA
GACCGACGAGGGCGATGTCGTCCTCAAATGCCCGACGGAAGTGACGATCACCGACCGTCGCGAGAAAGAG
CTGAATGACCTTGGCTTTATCGCGCTCGTGAACTCGAAGGGATCGAACTTCGCGACGTTCTTCGGCGGTC
AGACGACCAACCGCCCGAAGCTGTACAACAAGGACGCAGCCAACGCTAACTCGCAGCTTTCGGCGCGCTT
GCCGTACGTTCTCGCAGCCTCACGCTTCGCGCACTATCTGAAGGTGATGATGCGCGACAAGGTGGGCAGC
TTCCAGTCGCGCGGCGATGTCGAGGCGTATCTGAACAACTGGATTGCGGACTACGTGTTGATCAATCCGT
CGGCTTCGCACGAACAGAAGGCGCGCTTCCCGCTCGGCGAGGCACGCGTGGACGTGACGGAGGTGCAGGG
CAAGCCAGGCGCGTATCGCGCGACCTGCTTCCTGAAGCCCCATTTCCAGATGGAAGAACTGACGGCGTCG
ATCCGTCTCGTCGCGGAACTGCCGGCAGCGGCGGCCTGA
 Primer design