SecReT6
Protein ID: 295700992
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5446
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2456089..2456580 [+]
Producthypothetical protein
NoteTssD
UniProt IDD5WFZ8
KEGG IDbge:BC1002_5446
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-30, Aligned region: 6..134
Protein Sequence: 163 a.a.     [Download]
>gi|295700992|ref|YP_003608885.1| hypothetical protein [Burkholderia sp. CCGE1002]
MDTVLLQIKDIKGNSTLEGASEHIVLYSYSLGVTMQMNNDVGRTERTLGRPNFIEFNVNKATDQSTPALY
AACAGGTKLGEAKISIGRNENSKFMPLIEYTLSDAMISAITTSGSGESQDNVTINFSKITTTYTQQNVDS
TKKGTASFGWDLAANKPITVSAS
 
Nucleotide Sequence: 492 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2456089-2456580 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGATACCGTTCTGCTGCAGATAAAGGACATCAAGGGTAATTCGACACTGGAGGGCGCGAGCGAACATA
TCGTCCTGTATTCGTACTCGCTCGGCGTCACGATGCAGATGAACAACGACGTGGGCCGCACGGAACGTAC
GCTCGGTCGTCCGAACTTCATCGAATTTAACGTCAACAAGGCAACCGACCAGTCCACGCCGGCGCTTTAC
GCAGCTTGCGCCGGGGGCACGAAGCTCGGGGAAGCCAAGATTTCGATCGGGCGCAACGAAAACAGCAAGT
TCATGCCGCTGATCGAGTACACGCTCAGCGACGCCATGATCTCGGCGATCACGACTTCGGGCTCCGGCGA
ATCGCAGGATAACGTGACGATCAACTTCTCGAAGATCACGACCACATACACGCAGCAAAACGTCGACTCG
ACGAAGAAGGGTACCGCGTCGTTCGGCTGGGATCTGGCCGCGAACAAGCCTATTACGGTGTCGGCTTCCT
GA
 Primer design