SecReT6
Protein ID: 295700993
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5447
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2456648..2457085 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD5WFZ9
KEGG IDbge:BC1002_5447
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.50E-19, Aligned region: 27..125
Protein Sequence: 145 a.a.     [Download]
>gi|295700993|ref|YP_003608886.1| type VI secretion system lysozyme-like protein [Burkholderia sp. CCGE1002]
MPAIVIGSPMPLFDRLAASGEAQLAGEDGLRASIARELTRLLNTRSRLTFDEFAESDGSVIDYGVPDFSH
RSLHSGPDRDLIAAAIGRAISLFEPRLANVEVAFAFSAAHAQRAILTISAQMRAGQSVTHVAFELAANGH
TLVAA
 
Nucleotide Sequence: 438 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2456648-2457085 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGCCCGCAATCGTAATCGGTTCACCGATGCCATTGTTCGATCGCCTCGCCGCCAGCGGCGAGGCGCAGC
TTGCCGGCGAAGACGGGCTGCGGGCGTCGATCGCGCGTGAACTCACGCGACTGCTCAATACACGCTCTCG
TTTGACGTTCGACGAATTTGCCGAAAGCGACGGGAGCGTGATCGATTACGGCGTGCCCGATTTTTCGCAC
CGGTCGCTGCATTCGGGACCGGACCGTGATCTGATAGCCGCAGCGATCGGGCGGGCTATTTCGCTGTTCG
AGCCGCGCCTCGCCAATGTCGAGGTTGCGTTTGCCTTCTCCGCTGCGCACGCGCAGCGGGCAATTCTGAC
CATCAGTGCTCAAATGCGTGCTGGCCAAAGCGTCACGCACGTGGCATTCGAGCTGGCCGCCAACGGCCAT
ACGCTCGTCGCGGCGTGA
 Primer design