SecReT6
Protein ID: 295700994
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5448
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2457105..2458862 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDD5WG00
KEGG IDbge:BC1002_5448
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-186, Aligned region: 7..585
Protein Sequence: 585 a.a.     [Download]
>gi|295700994|ref|YP_003608887.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MPADDILQYYKRELSYLRLQGAEFARRYPKIASRLALHGTESLDPHTERLVEATAFLAARVHRDLDQEFP
QVASALLENVCPTLVQPVPSMTVAQFDLDPSQGKVTAGFAVPRHTGLQARTETGDACRFRTAWDTVLWPI
GIRHAAFGEDATLRLTLECAEGVDFAELEIRQLRLHLHGDWMVTMPLYELLVSGVTDVSVRPEGARAPSL
LPARAWREVGYGEADDVLPRPRHAQPAYALMQEYFAFPRKFHFFDLHHLEGRLGKGRRCEIVLHLNRTPR
GLGMLHAGHFQLGCAPVINLFSQTSEPIVVDHRHYEYRLVADQRRESITEIHSIESVVASHPTLGAEAAV
PCFSAIDHVEADGDTVFWSARREHSLRENVQGTDMFLSFVDSANVLADPGAPVIYANVLCTNRRLAEQVP
VGARMLIEKVSQNVRVRCLYEPTAQRSPALGSETLWRLISLLTLNYQSLVSGATGRAQLQEMLRLFASDS
TREQDQIRGIRSVEARSATAHVGSDAWRGYCRGTEVAVEFDPETFVGGSPLLLGAVLARFFAMYTSVNSF
VRLVVRRGDEIWKQWEPMTGCQQLL
 
Nucleotide Sequence: 1758 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2457105-2458862 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGCCGGCCGACGACATCCTCCAATACTACAAACGCGAGCTTTCGTACCTGCGTCTGCAAGGTGCGGAGT
TCGCGCGTCGCTACCCGAAAATCGCTTCGCGTCTCGCGCTGCACGGCACCGAGTCGCTCGACCCGCATAC
TGAGCGTCTCGTCGAGGCGACCGCATTTCTCGCCGCGCGCGTGCATCGCGATCTCGACCAGGAGTTCCCG
CAGGTCGCTTCAGCGTTGCTCGAGAACGTGTGCCCGACGCTCGTGCAACCCGTACCGTCGATGACGGTCG
CGCAGTTCGACCTCGATCCGAGCCAGGGCAAGGTGACGGCCGGTTTTGCCGTGCCGCGTCACACGGGCCT
GCAGGCCCGCACGGAAACGGGCGACGCGTGTCGCTTTCGCACGGCGTGGGATACGGTGCTGTGGCCGATT
GGCATCCGCCATGCGGCGTTCGGCGAAGACGCCACGCTGCGTCTCACGCTGGAATGCGCAGAGGGTGTCG
ACTTCGCAGAGCTGGAGATCAGGCAACTTCGCCTGCACCTCCACGGCGACTGGATGGTGACGATGCCGCT
CTACGAACTGCTGGTGTCGGGTGTAACGGACGTCTCGGTGCGACCGGAAGGCGCAAGGGCGCCGTCGTTG
TTGCCCGCGCGCGCGTGGCGCGAAGTGGGCTATGGCGAAGCGGACGACGTGCTACCGCGCCCACGCCACG
CGCAGCCGGCGTATGCGCTGATGCAGGAATACTTCGCGTTTCCGCGCAAGTTTCATTTTTTCGATCTGCA
CCATCTCGAAGGACGGCTCGGCAAGGGACGCCGTTGCGAGATCGTGCTGCACCTGAACCGCACTCCGCGT
GGTCTCGGCATGCTGCACGCGGGGCATTTCCAGCTCGGCTGCGCGCCCGTCATCAACCTGTTCTCGCAGA
CGAGCGAGCCGATCGTCGTGGATCACCGTCACTATGAGTACCGCCTCGTTGCGGACCAGCGGCGCGAGTC
GATCACGGAGATTCACTCGATCGAGTCCGTCGTCGCGTCGCATCCGACTCTTGGGGCCGAGGCGGCGGTG
CCGTGCTTTTCGGCCATCGATCACGTCGAGGCCGATGGCGACACCGTGTTCTGGTCCGCGCGCCGGGAGC
ATAGCCTGCGAGAGAACGTGCAGGGCACGGACATGTTCCTGAGTTTCGTCGATTCGGCCAACGTGCTAGC
CGATCCCGGCGCACCCGTGATCTACGCGAACGTGCTGTGCACGAATCGCCGTCTTGCCGAACAGGTGCCA
GTAGGCGCTCGCATGCTGATCGAGAAGGTCTCGCAGAACGTGCGCGTGCGCTGCCTTTACGAGCCGACCG
CTCAGCGCAGCCCTGCACTCGGCAGCGAAACGCTATGGCGGCTGATCTCGCTGCTCACGCTCAACTATCA
GTCGCTCGTGAGCGGCGCGACGGGCCGCGCGCAGTTGCAGGAAATGCTGCGGCTGTTCGCCTCCGACAGC
ACGCGCGAGCAGGACCAGATTCGCGGCATCCGCAGCGTGGAGGCCCGCAGCGCGACCGCGCATGTCGGCA
GCGACGCATGGCGCGGCTATTGCCGCGGCACCGAGGTCGCCGTCGAGTTCGATCCCGAGACCTTCGTGGG
CGGCTCGCCGTTGCTGCTGGGGGCCGTGCTCGCGCGCTTCTTCGCGATGTACACGTCGGTCAATTCCTTT
GTACGGCTGGTGGTGCGCCGTGGAGACGAGATATGGAAGCAATGGGAGCCGATGACAGGCTGCCAGCAGC
TGCTCTGA
 Primer design