SecReT6
Protein ID: 295700995
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5449
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2458817..2459911 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDD5WG01
KEGG IDbge:BC1002_5449
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-80, Aligned region: 21..337
Protein Sequence: 364 a.a.     [Download]
>gi|295700995|ref|YP_003608888.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MEAMGADDRLPAAALIARLKANPQRFDLFQAISLLERAAPWARALGRGNGLGEAVRLTGHVSLAFEPSDV
HSVREKTSAQQDGMPSDTSVSYAPRATWTLSTPVLTLAGANGPLPMAYTELVLERRAQRDTATADLLDIF
NHRFLSFLYRSRKKHSPGLNWRSPHASAIAASLDALSNLGLRDGMRGPRDARLWLRHAGLLSAAPRSMTG
LVAMLADRLGLEVRGAQFVGGWREVDRADSLRLGRAGAARLTGVAVLGRRTWDQASGICLEFPGLTRARF
EALLPGGADHALAAWLVRAYLQQDFDVQFVLHLASQTTACEVGGPRASRLGWTTWLGGSRHTTHAPAPVR
LALSEAAAPAPKVH
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2458817-2459911 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGAAGCAATGGGAGCCGATGACAGGCTGCCAGCAGCTGCTCTGATCGCGCGTCTCAAGGCGAATCCGC
AGCGCTTTGATCTGTTCCAGGCGATCAGTCTGCTGGAGCGAGCCGCGCCGTGGGCGCGTGCGCTCGGCCG
TGGCAATGGGCTGGGCGAGGCGGTCCGCCTCACCGGCCACGTGTCGCTTGCATTCGAGCCGAGCGACGTC
CACAGCGTGCGCGAGAAGACGTCGGCGCAACAGGACGGCATGCCCTCTGACACCAGTGTGTCGTACGCGC
CGCGTGCAACCTGGACGCTGTCCACGCCCGTGCTTACGCTCGCGGGCGCCAACGGCCCGCTGCCAATGGC
GTACACCGAACTCGTGCTGGAGCGCCGCGCGCAGCGCGACACGGCGACGGCGGACCTGCTCGACATCTTC
AATCACCGCTTTCTGTCGTTCCTGTATCGCAGTCGCAAGAAGCACTCGCCGGGGCTCAATTGGCGCTCGC
CACACGCGAGCGCGATCGCGGCCTCTCTCGACGCGCTCAGCAATCTGGGCCTGCGCGACGGCATGCGCGG
CCCGCGTGACGCGCGGCTGTGGTTGCGCCACGCAGGGCTGCTGAGCGCCGCGCCACGCTCGATGACGGGA
CTCGTCGCGATGCTTGCCGACCGCCTCGGGCTCGAAGTGCGCGGCGCGCAATTCGTCGGCGGCTGGCGCG
AGGTCGACCGCGCCGACTCGCTGCGCCTCGGGCGCGCGGGGGCTGCGCGGCTCACCGGTGTGGCCGTGCT
GGGGCGCCGCACGTGGGACCAGGCGAGCGGCATCTGCCTCGAGTTTCCCGGCCTGACCAGGGCGCGCTTC
GAGGCGCTTTTGCCCGGCGGCGCCGATCACGCGCTCGCCGCGTGGCTCGTTCGCGCGTATCTGCAGCAGG
ATTTCGACGTGCAGTTCGTGCTGCATCTCGCGTCGCAAACCACCGCCTGCGAAGTCGGTGGCCCGCGCGC
GTCCCGCCTCGGCTGGACGACGTGGCTGGGCGGCTCGCGCCATACCACTCACGCACCGGCACCGGTACGC
CTCGCGCTGAGCGAGGCCGCCGCGCCCGCGCCGAAGGTTCACTAA
 Primer design