SecReT6
Protein ID: 295700996
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5450
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2459923..2462655 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD5WG02
KEGG IDbge:BC1002_5450
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.40E-39, Aligned region: 250..268
AAA_2 [PF07724], Evalue: 7.40E-39, Aligned region: 637..801
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 250..382
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 643..769
ClpB_D2-small [PF10431], Evalue: 3.30E-14, Aligned region: 809..880
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 228..273
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 294..329
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 385..460
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 611..663
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 706..731
AAA_5 [PF07728], Evalue: 7.80E-13, Aligned region: 250..273
AAA_5 [PF07728], Evalue: 7.80E-13, Aligned region: 348..380
AAA_5 [PF07728], Evalue: 7.80E-13, Aligned region: 642..752
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 249..336
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 367..422
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 641..731
IstB_IS21 [PF01695], Evalue: 1.40E-06, Aligned region: 232..274
IstB_IS21 [PF01695], Evalue: 1.40E-06, Aligned region: 642..660
Sigma54_activat [PF00158], Evalue: 6.60E-06, Aligned region: 245..329
Sigma54_activat [PF00158], Evalue: 6.60E-06, Aligned region: 642..765
AAA_17 [PF13207], Evalue: 8.30E-06, Aligned region: 250..292
AAA_17 [PF13207], Evalue: 8.30E-06, Aligned region: 641..678
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 250..274
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 442..482
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 640..664
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 250..277
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 642..667
AAA_25 [PF13481], Evalue: 5.80E-05, Aligned region: 245..327
AAA_25 [PF13481], Evalue: 5.80E-05, Aligned region: 640..664
Clp_N [PF02861], Evalue: 6.40E-05, Aligned region: 23..73
Clp_N [PF02861], Evalue: 6.40E-05, Aligned region: 107..124
Clp_N [PF02861], Evalue: 6.40E-05, Aligned region: 337..347
AAA_29 [PF13555], Evalue: 0.00017, Aligned region: 242..265
AAA_29 [PF13555], Evalue: 0.00017, Aligned region: 640..668
AAA_14 [PF13173], Evalue: 0.00031, Aligned region: 250..353
AAA_14 [PF13173], Evalue: 0.00031, Aligned region: 641..723
Zeta_toxin [PF06414], Evalue: 0.00039, Aligned region: 250..270
Zeta_toxin [PF06414], Evalue: 0.00039, Aligned region: 641..682
Arch_ATPase [PF01637], Evalue: 0.00039, Aligned region: 229..270
Arch_ATPase [PF01637], Evalue: 0.00039, Aligned region: 303..341
Arch_ATPase [PF01637], Evalue: 0.00039, Aligned region: 641..654
AAA_18 [PF13238], Evalue: 0.00098, Aligned region: 250..273
AAA_18 [PF13238], Evalue: 0.00098, Aligned region: 643..671
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 250..280
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 299..330
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 607..676
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 250..279
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 641..675
DUF815 [PF05673], Evalue: 0.0056, Aligned region: 244..325
DUF815 [PF05673], Evalue: 0.0056, Aligned region: 599..680
RNA_helicase [PF00910], Evalue: 0.0078, Aligned region: 251..271
RNA_helicase [PF00910], Evalue: 0.0078, Aligned region: 643..664
AAA_23 [PF13476], Evalue: 0.0085, Aligned region: 250..266
AAA_23 [PF13476], Evalue: 0.0085, Aligned region: 480..527
AAA_23 [PF13476], Evalue: 0.0085, Aligned region: 640..666
Protein Sequence: 910 a.a.     [Download]
>gi|295700996|ref|YP_003608889.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1002]
MDIDIRTLLSRLNPECKLAMEQAAQLCVRQTHYNVDVEHLLLTLLESDAPDLKAILAHFAVKPETLSAQL
QKTVDGFKRGNGRTPALSPNFSPLFQEAWLLSSMLLGEQQIRSGTLVLALLEVDTLRGMLLESAPALLNF
PRAALRDRLAAILAGSSEDAGGSHMPGQDSEAAQPGAASASASSAARETGAMPNIAGGAGGSGRKSALEL
YTVDMTGLAREGKIDPIRGRDAEIRQLIDVLLRRRQNNPILTGEAGVGKTAVVEGFAQRIVQGDVPPALV
NVSVRSLDLALLQAGAGVKGEFENRLKSVIAEVKASPVPVILFIDEAHQLIGAGGSEGQGDAANLLKPAL
ARGELRTIAATTWAEYKKYVERDPALARRFQVVKVEEPSEAVAIDMLRGMVQKLEEHHGVEILDDAVRDA
VKLSHRYISGRQLPDKAISVLDTACARVAIGQSGTPEEIEALGRTIEAAERQLRILRHEAATGADRADAI
AVTTKQLDDARAQRSRLTDKLATEKRAVEEILAWRKKIRGYLSDPDSAADGEDAASLAVNLSRLEKGLEA
MQNDEPMVPVCVDSETVAQVISGWTGIPVGRMLADELHTVLYLQDKLAERVVGQDEALDAIARRVRTFRA
DLDDPGKPVGVFLLVGPSGVGKTETACALADMLYGGERNMITVNMSEFQEAHSVSGLKGAPPGYVGYGRG
GVLTEAVRRRPYSVVLLDEMEKAHPDVLELFFQVFDKGVMEDGEGVPIDFKNTLILLTSNAAQDVITEAS
RGGRRPPPDELIEKLRPALLRQFSPAFLGRLVLVPYYHLGDAQINAIVNLKLERLAQRFERNHHAGLTWD
DDVATLIAQRCKEVDSGARNVDHILTQSVLPELARQVLERISISEPFGGVHLALSPTGAIEFRFLSSEEA
 
Nucleotide Sequence: 2733 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2459923-2462655 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGATATCGATATTCGCACGCTGTTGAGCCGCCTGAATCCGGAATGCAAGCTCGCGATGGAACAGGCCG
CGCAGCTGTGCGTGCGACAGACGCATTACAACGTCGACGTCGAGCATCTGCTGCTCACGCTGCTCGAATC
CGATGCGCCGGACCTCAAGGCCATTCTTGCGCACTTCGCCGTCAAGCCCGAAACGCTGAGCGCGCAGCTG
CAGAAGACGGTTGATGGATTCAAGCGCGGCAATGGCCGCACGCCGGCGCTTTCGCCGAACTTTTCGCCGC
TCTTCCAGGAAGCGTGGCTGCTCAGCTCGATGCTGCTCGGCGAGCAGCAGATCCGCTCGGGCACGCTCGT
TCTCGCGCTGCTCGAAGTCGATACTCTGCGCGGCATGCTGCTCGAATCGGCCCCCGCACTGCTCAACTTC
CCGCGCGCGGCCCTGCGCGACCGGCTCGCGGCGATTCTCGCGGGCTCGTCCGAAGATGCGGGCGGCTCGC
ACATGCCCGGCCAGGACTCCGAAGCGGCGCAGCCTGGCGCGGCGTCCGCGTCTGCATCGTCTGCGGCGCG
AGAGACGGGTGCGATGCCGAACATCGCGGGCGGCGCTGGCGGAAGCGGCCGCAAGTCGGCGCTGGAGTTG
TATACCGTCGACATGACCGGCCTCGCGCGCGAAGGCAAGATCGATCCGATTCGCGGACGCGACGCTGAAA
TCCGCCAGTTGATCGACGTGCTGCTGCGCCGCCGCCAGAACAACCCGATCCTCACGGGCGAAGCGGGCGT
GGGCAAAACAGCCGTGGTCGAGGGTTTCGCCCAGCGCATCGTGCAGGGCGACGTGCCGCCCGCGCTCGTC
AACGTGTCGGTGCGCTCGCTCGATCTTGCGCTGCTGCAGGCAGGCGCGGGCGTGAAGGGCGAGTTCGAGA
ACCGGCTCAAGTCGGTGATTGCGGAGGTGAAGGCGTCGCCGGTGCCGGTCATCCTGTTCATCGACGAGGC
GCATCAGCTGATCGGCGCGGGCGGCAGCGAGGGCCAGGGCGACGCAGCCAACCTGCTCAAGCCGGCGCTC
GCGCGCGGCGAGCTGCGCACGATCGCCGCGACCACGTGGGCCGAATACAAGAAATACGTGGAACGCGATC
CAGCGCTCGCGCGGCGCTTCCAGGTGGTCAAGGTCGAGGAGCCGAGCGAGGCCGTCGCGATCGACATGCT
TCGCGGCATGGTGCAGAAACTCGAAGAGCACCACGGCGTGGAAATCCTCGACGACGCGGTGCGCGACGCC
GTGAAGCTGTCGCATCGTTACATCTCCGGGCGCCAGTTGCCGGATAAGGCGATCAGCGTGCTCGACACGG
CGTGCGCCCGCGTGGCGATCGGCCAAAGCGGCACGCCCGAGGAAATCGAGGCGCTTGGCCGCACGATCGA
AGCGGCCGAGCGCCAGCTTCGCATCCTGCGCCACGAGGCGGCCACGGGGGCCGATCGTGCTGACGCCATC
GCTGTGACTACGAAGCAGCTCGACGACGCGCGCGCGCAGCGCTCGCGCCTCACCGACAAGCTCGCCACCG
AAAAGCGCGCAGTGGAGGAGATCCTCGCGTGGCGCAAGAAGATTCGCGGCTATCTGTCGGACCCGGACAG
CGCGGCCGATGGCGAGGATGCGGCATCGCTCGCGGTGAATCTCTCGCGCCTCGAAAAAGGCCTTGAAGCC
ATGCAGAACGACGAGCCGATGGTGCCCGTATGCGTGGACTCGGAGACGGTCGCCCAGGTCATTTCGGGCT
GGACCGGCATCCCCGTTGGCCGCATGCTCGCCGACGAGCTGCACACCGTGCTGTATCTCCAGGACAAGCT
TGCCGAGCGCGTAGTCGGCCAGGACGAAGCGCTCGACGCGATCGCGCGGCGCGTGCGAACGTTCCGCGCC
GATCTCGACGATCCGGGCAAGCCGGTGGGTGTGTTCCTGCTCGTCGGGCCGAGCGGCGTGGGCAAGACCG
AGACAGCGTGCGCGCTCGCGGACATGCTGTACGGCGGCGAGCGCAACATGATCACCGTGAACATGTCGGA
GTTTCAGGAGGCGCACAGCGTGTCCGGGCTCAAGGGCGCGCCGCCGGGATATGTCGGCTACGGACGTGGC
GGCGTGCTCACCGAGGCCGTGCGCCGCCGTCCGTATAGCGTCGTGCTGCTCGATGAAATGGAGAAGGCGC
ACCCCGACGTGCTGGAGCTGTTCTTCCAGGTGTTCGACAAGGGCGTGATGGAAGACGGCGAAGGCGTGCC
GATCGACTTCAAGAACACGCTCATTCTGCTGACCTCGAACGCCGCGCAGGATGTCATTACCGAAGCGAGC
CGGGGCGGCCGCCGCCCGCCGCCCGACGAGTTGATCGAGAAGCTGCGCCCGGCGCTGCTGCGGCAGTTCA
GCCCGGCTTTTCTGGGGCGGCTCGTGCTCGTGCCTTACTACCACCTCGGCGACGCGCAGATCAACGCGAT
TGTGAACCTGAAGCTCGAACGGCTCGCGCAGCGCTTCGAGCGCAATCATCACGCTGGCCTCACGTGGGAC
GATGACGTGGCCACGCTGATCGCGCAGCGCTGCAAAGAAGTGGATAGCGGCGCGCGCAATGTGGACCACA
TCCTCACGCAGTCCGTGCTGCCGGAGCTCGCGCGCCAGGTCCTCGAGCGCATTTCGATTTCCGAACCATT
TGGCGGCGTGCATCTCGCGCTGAGTCCGACCGGCGCGATCGAGTTCCGCTTCCTCTCCAGCGAGGAGGCG
TAA
 Primer design