SecReT6
Protein ID: 295700997
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5451
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2462660..2464582 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDD5WG03
KEGG IDbge:BC1002_5451
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-74, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 2.20E-23, Aligned region: 356..449
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 56..63
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 281..287
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 354..362
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 453..458
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 491..513
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 502..523
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 525..546
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 542..564
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 557..579
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 565..586
Gp5_C [PF06715], Evalue: 1.20E-06, Aligned region: 616..626
Protein Sequence: 640 a.a.     [Download]
>gi|295700997|ref|YP_003608890.1| ImpA family type VI secretion-associated protein [Burkholderia sp. CCGE1002]
MSTPSQSNWFASVSTPFGADVLLLDGFGGHEAISELFSFDLRMRSTNKALAPDEIVGKSVTVTLKDQSGV
ARYFNGIVTRFAHAGADAQHGFYSAELAPRLWLLTLGRDRVIWQNQSALDIIKSVLGTFGVTFEDRTKSS
SAYGVREYCVQYDESAFHFISRLMEEEGIFYFFTFADGAHTMVLADDPSAHDATPAGNLYFDADANTASS
AKRLDSFAMARGVIPGEHIVSDYDYTKPATMISSSKGSSSLPTGARYTFPGRVATAGQATHLSTTQLEAH
NVTQQVGQGASGYYGLAAGTTFTLGGHPDSSLNVSYVARSVRHTASNNAYSNEFEVFPVTVPYRAPLATP
RPLVAGTHTAKVVGSTDEEIWTDAQGRIKVKFHWDRTEEADQNSSCWVRVAQSVAGPGWGHLFLPRVGQE
VVVSYVDGDPDRPLVTGCVYNGENATPVTLPANQTQSVMRSRSSKKGTAGNEIRMEDKLDSEQLYFHAQK
DMTVEIENALSTTVKAGDETHTVTQGNRTISVSKGNESHTVKGTRTLDVTDDETHTNHAKFTHSVTGDHA
HTVNGNYTLKVGGNLVIEVTGSVSIKAGSSFASEAGTTHSSKATTTLSTEGMTVSHKASAQQTVDGGGQL
ALKGGIVQLN
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2462660-2464582 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGTCGACGCCCAGCCAGTCGAACTGGTTTGCATCGGTCTCGACGCCGTTCGGCGCGGACGTGCTATTGC
TCGACGGTTTTGGAGGCCATGAAGCGATCTCGGAGCTATTCAGCTTCGATCTGCGGATGCGTTCGACGAA
CAAGGCGCTCGCTCCCGACGAGATCGTCGGCAAAAGCGTGACGGTGACGCTCAAGGACCAGAGCGGTGTC
GCAAGGTATTTCAACGGCATCGTGACGCGCTTCGCACATGCGGGAGCGGACGCGCAGCACGGCTTCTATT
CGGCGGAGCTTGCGCCGCGCCTATGGTTGCTCACGCTCGGGCGGGACCGCGTGATCTGGCAGAACCAGTC
GGCGCTCGACATCATCAAGAGTGTGCTGGGCACGTTCGGCGTCACCTTCGAGGACCGCACGAAGAGCAGC
AGCGCCTATGGCGTGCGCGAATACTGCGTTCAGTACGATGAAAGCGCCTTTCACTTCATCTCGCGGCTGA
TGGAAGAGGAAGGTATTTTCTATTTCTTCACGTTCGCGGACGGTGCGCACACGATGGTGCTCGCCGACGA
CCCTTCCGCTCACGACGCAACTCCGGCCGGCAACCTGTATTTCGACGCCGACGCGAATACCGCCAGCAGC
GCGAAGCGACTCGATTCGTTCGCGATGGCGCGGGGCGTCATACCCGGCGAGCACATCGTCAGCGACTACG
ACTACACCAAGCCGGCGACGATGATTTCATCGTCGAAGGGTTCGTCGAGCTTGCCGACCGGCGCGCGTTA
TACGTTTCCCGGCCGTGTGGCCACGGCCGGGCAGGCGACCCATCTATCGACCACTCAACTCGAAGCGCAC
AACGTCACGCAGCAGGTGGGGCAGGGCGCCAGCGGGTACTACGGCCTCGCCGCCGGCACCACGTTCACGC
TCGGCGGGCATCCGGACAGTTCGCTCAACGTGAGCTATGTCGCGCGCTCGGTGCGGCATACGGCTTCGAA
TAACGCCTACAGCAACGAATTCGAGGTATTTCCTGTCACCGTGCCGTATCGCGCGCCGCTCGCGACGCCC
CGGCCGCTCGTGGCGGGCACGCACACGGCGAAAGTAGTCGGCTCGACCGATGAGGAAATCTGGACCGACG
CGCAAGGCCGTATCAAGGTCAAGTTCCACTGGGATCGCACAGAAGAGGCCGACCAGAACAGCTCCTGCTG
GGTGCGCGTGGCGCAGTCGGTGGCCGGGCCGGGCTGGGGGCACCTGTTCCTGCCGCGTGTGGGGCAGGAA
GTCGTCGTGAGCTATGTGGATGGAGATCCGGACCGGCCGCTCGTCACCGGGTGTGTCTACAACGGAGAGA
ACGCGACGCCCGTCACGCTGCCGGCGAACCAGACGCAGAGCGTGATGCGTTCCCGCTCGTCGAAGAAAGG
CACGGCTGGCAACGAGATTCGCATGGAGGACAAGCTCGATTCGGAACAGCTGTACTTCCACGCGCAGAAG
GACATGACAGTCGAGATCGAGAACGCTCTTTCGACCACCGTGAAGGCCGGCGACGAAACGCACACCGTGA
CGCAGGGCAATCGCACGATCTCGGTGAGCAAGGGCAACGAGTCGCACACCGTGAAGGGCACACGCACGCT
CGACGTAACAGACGACGAAACGCACACGAACCACGCGAAGTTCACGCACAGCGTGACGGGCGATCACGCG
CATACGGTCAACGGCAATTACACGCTGAAGGTGGGTGGCAATCTGGTAATCGAGGTGACCGGCTCGGTGA
GTATCAAGGCCGGCTCGTCGTTCGCGAGTGAAGCCGGCACCACGCACTCGAGCAAGGCCACGACCACGCT
GAGCACCGAGGGCATGACGGTTTCGCACAAGGCGTCGGCGCAGCAGACGGTCGACGGCGGCGGCCAGCTC
GCGCTCAAGGGCGGCATTGTCCAGCTCAATTGA
 Primer design