SecReT6
Protein ID: 295701006
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5460
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2470905..2472239 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDD5WG12
KEGG IDbge:BC1002_5460
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-70, Aligned region: 25..429
Protein Sequence: 444 a.a.     [Download]
>gi|295701006|ref|YP_003608899.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MMHDRNMAVPERIEWFEGMLLSPQHFQQMASRTDALVAWQTLAAAPFSWGVRRLVFDNGLLPAGLLRVLE
LDAILPDGTAVTYHAQAAGAERLELSLEPFADALSNGPLDFYLVLPGASTMRRAAQVRRFRSTSVAPVED
LVSDAPPADIARLVPNLALAAGELPSAMHVWLRLGSLYKDNEVVRLGEHQPPLLEVARDNPLWTSVASLL
GQLRGKAAFVARQTANPSSRVDDRLTQLELKDRLRSLLSALPLAEAVLRTPHLHPLALYHALAALNGSLA
MLKPGGLPPVPPDYDHGDPLSVFTPLLRSLRESMSEVNEEHREHKFEFRHGAFEITLHPDWIGERLVVGL
RGQSDRDLLAWMDGAVIGSQSVYASLRSRRVLGAARRGIDYAEDLGLRSGSGYLLFEVTAEAALVLASET
LVIGNPNEGTSAQRPQEMLLFVKG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2470905-2472239 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGATGCATGACCGCAATATGGCAGTACCCGAGCGGATTGAGTGGTTCGAGGGCATGTTGCTCTCGCCCC
AGCATTTTCAGCAGATGGCCTCGCGCACCGATGCGCTCGTGGCGTGGCAGACGCTCGCGGCGGCGCCGTT
CAGCTGGGGCGTGCGACGCCTCGTGTTCGACAACGGGCTGCTGCCCGCAGGGCTGCTGCGCGTGCTGGAA
CTCGACGCGATCCTGCCCGATGGCACGGCCGTCACCTACCATGCGCAGGCCGCGGGCGCGGAGCGGCTGG
AATTGTCGCTGGAGCCGTTCGCCGACGCGCTTTCGAACGGGCCGCTCGACTTCTATCTCGTGCTGCCCGG
CGCATCGACGATGCGGCGAGCGGCGCAGGTCAGGCGCTTTCGCTCGACGTCCGTCGCGCCCGTGGAGGAC
CTGGTGTCCGACGCGCCGCCCGCCGACATTGCGCGCCTCGTCCCAAACCTTGCGCTGGCGGCGGGCGAGT
TGCCATCGGCGATGCACGTGTGGCTGCGGCTTGGTTCGCTGTACAAGGACAACGAAGTCGTGCGGCTAGG
CGAACACCAGCCGCCGCTTCTCGAAGTCGCCCGTGACAATCCTTTGTGGACGAGCGTGGCCTCGCTGCTG
GGTCAGTTGCGTGGCAAAGCAGCATTCGTCGCGCGGCAGACCGCGAATCCTTCGTCGCGGGTTGACGATC
GTCTTACACAGCTGGAGCTGAAGGACCGCTTGCGCAGTCTGCTGAGCGCGCTGCCGCTTGCCGAAGCGGT
GCTGCGCACGCCGCATCTGCATCCGCTTGCGCTGTATCACGCGCTTGCCGCACTCAACGGTTCGCTCGCC
ATGCTCAAGCCCGGTGGACTACCGCCCGTGCCGCCCGACTACGATCACGGCGATCCGCTGTCGGTGTTCA
CGCCGCTGCTGCGCTCGCTGCGCGAGTCGATGTCGGAGGTGAACGAGGAGCATCGCGAGCACAAGTTCGA
ATTCCGCCATGGTGCGTTCGAAATCACGCTGCATCCGGACTGGATCGGCGAACGGCTCGTCGTGGGCCTG
CGCGGCCAGTCCGATCGCGACCTGCTCGCGTGGATGGACGGCGCGGTGATCGGCTCGCAGTCGGTCTATG
CCTCGCTGCGCAGCCGCCGGGTGCTCGGCGCGGCCCGGCGCGGCATTGACTATGCGGAAGATCTCGGTTT
GCGCTCAGGCTCGGGCTACCTGCTGTTCGAGGTGACGGCGGAGGCCGCGCTCGTGCTCGCGAGCGAAACG
CTTGTCATCGGTAACCCCAACGAAGGAACAAGCGCGCAGCGACCGCAGGAAATGCTGCTGTTCGTGAAGG
GATGA
 Primer design