SecReT6
Protein ID: 295701007
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5461
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2472292..2473044 [+]
Producttype IV / VI secretion system, DotU
NoteTssL
UniProt IDD5WG13
KEGG IDbge:BC1002_5461
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-36, Aligned region: 19..234
Protein Sequence: 250 a.a.     [Download]
>gi|295701007|ref|YP_003608900.1| type IV / VI secretion system, DotU [Burkholderia sp. CCGE1002]
MARIRPEAEEDDLVTEQFRTFLDELMMAQARFSELPDADPDLAAQGLSRHLLNLLEIQTLQSRRDSTRFE
MEIVADARYLKAVLADEILLNTPWAGRERWTAYLLESTLFRTNVAGDLVFRRIEQLLSERETSRRSIARL
YLFSLAMGFQGRFRGADAAERLRSYREELYEFVYQRRADLGGRDRVLSEIAYANTLSHVAPRKLPTVSRW
AMIFMLVAVSLLAISEVLWLWQSWPVREALHADPVTGVSR
 
Nucleotide Sequence: 753 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2472292-2473044 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGCACGCATCCGACCAGAAGCAGAAGAAGACGATCTCGTGACGGAGCAGTTCCGCACCTTCCTCGACG
AGCTGATGATGGCTCAGGCGCGCTTCTCCGAACTGCCCGACGCAGACCCGGATCTCGCCGCGCAGGGATT
GAGCCGGCACCTGCTGAACCTGCTGGAGATCCAGACGCTGCAATCGCGGCGTGACAGCACGCGCTTCGAA
ATGGAGATCGTCGCGGACGCGCGCTACCTGAAGGCCGTGCTCGCCGATGAAATCCTGCTGAATACGCCGT
GGGCCGGACGCGAGCGCTGGACCGCGTATCTGCTCGAATCGACGCTGTTTCGCACCAACGTGGCGGGTGA
CCTGGTGTTCCGCCGCATCGAGCAACTGCTGTCCGAGCGCGAAACATCGCGCCGCAGCATCGCACGCCTT
TATCTGTTCTCGCTCGCCATGGGCTTCCAGGGCCGCTTTCGCGGCGCGGACGCCGCCGAGCGCCTGCGCA
GCTACCGGGAGGAACTCTACGAGTTCGTCTATCAGCGCCGCGCCGATCTGGGCGGCCGCGACCGCGTGCT
TTCCGAGATCGCCTATGCGAACACGCTCTCGCATGTCGCGCCGCGCAAGCTGCCGACCGTGAGCCGCTGG
GCGATGATTTTTATGCTGGTAGCCGTGTCGCTGCTGGCGATTTCCGAGGTGCTCTGGCTGTGGCAGTCGT
GGCCCGTGCGCGAAGCCCTGCACGCCGACCCCGTGACGGGGGTGAGCCGATGA
 Primer design