SecReT6
Protein ID: 295701008
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5462
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2473112..2477305 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDD5WG14
KEGG IDbge:BC1002_5462
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-39, Aligned region: 138..434
ImcF-related_N [PF14331], Evalue: 2.40E-39, Aligned region: 1102..1138
Protein Sequence: 1397 a.a.     [Download]
>gi|295701008|ref|YP_003608901.1| IcmF-like protein [Burkholderia sp. CCGE1002]
MLTSNLFLLSIAVLTLVACAVLGAVIYFALHGSHTKPSAERKIVRLRSDSLRSAFRQAVELIEGNIATRA
ERYNIPWIMILNEGDDPRPLPIAQAGVASVLGADAASPAATQGISWHFFDRGIVVDIKAAYLGSPDDDGD
GKPWDEFLSLCRNYRQQRPFDSVVITVPAATLLADDTDARLELVRHAKLAHRRLWLAQNRFAMRFAVYVV
VTGCESLPGFATFARALPEPLRASMLGWSSPYDLSTTYQPGWVGTAMNSIMRSVSDASAELFALDSSHLD
ARQFLQLPSRIDAMRAQLQLYVDELLRASAYHEPFFFRGIYLTGDASEFAQWSVTQATKPTVEGDALSAL
EAPSGESHDALTAYAGSGSLHAAENMHSAEMGDGRREPGGQFNDLMLQPAFLRDLFEKKIFLEYGLTRPS
RSQHLTRPVLNRALRWGGIALLGGWGLGLVIATVQLSHRNGELVAALGALRRDSAERANAAQQGQDLPAD
WYRRKALALIAMNQNLRTSSGWTIFMPGSWGFVDDLNARVKDRFEREFGEIAVAALEREMYAHVSQLTGV
GRDPSSGQLIIGDDCTAPDAGRVGAPLGLAVDDLPQMHALQLYVHNVDQLDAALQALQRLQQPAPDNADS
LRLVVRYALGADLQGNVAGSVPYFYRDQDRRSVTGNGTAGVNLAAVQQALRCTLDKGAQQLDAAMFTGNP
LLVAERSISDRLGSLTVADSGAGDFTKLTDGYRAVVAGIDTQRDLLASGKGGWIHQTQFTPGPTYDRTLA
HVAQSRLLGADLAAQIRHRDDSAFQAFRSEFALRFGSADSGIVWIDKDARYSISPARAALRDGLSGLLSQ
PFMIAPRNRELPTLTDGSTIVWDRAQLDQALALGDVRKRFLAEGLANLPAAARPGIETALDLQFARLILD
QTAAAANVTTAPADLDSAAFEAARARLTRIDALLTELHANAQLEDIDTLVSNDAMAHLRRVDDALTQSEL
YATRQDVSADSAHNSRSPILAAFGVADAAALAPYLDQQSSRALMLGKQASVYLAALDPSGAASPLAQRWQ
AINRDLERYRLKNPNSSLLRLEQFALSVAADPGPAGCMSKFTGRPTTNGGDDYFATLHARLYDRLLARCS
QGYVFDMRRQWGNFATAFNESVAGRMPFDNGDMLRVATRNSGMPGVADFGELGQVLKRYEPVSETFHASG
AGASSAMTNYKVRQFIENFDQVKTLLAPLYPSDDGAATGYDVNVEFRANRNGEVAANQIIDWTLTIGSQS
LSMNEAPHALHWDFGTPVSLVLRFAKDSPLAAAEDAQQRAYSTDGRTLTWQFSDPWALITFINRQRAADA
SGRGERASQLLKIEFPLGTANPADLSLLPKQAHGRVYLRIALMPAGKKTPLPWPGSFPVRAPEWSAL
 
Nucleotide Sequence: 4194 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2473112-2477305 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGCTGACGAGCAACCTGTTCCTGCTTTCCATCGCGGTGCTTACGCTCGTTGCGTGCGCGGTGCTCGGCG
CGGTGATTTACTTCGCGTTGCATGGCTCGCACACGAAGCCCAGCGCGGAACGCAAGATCGTGCGCCTGCG
CTCGGACTCGCTGCGTAGCGCCTTCCGCCAGGCCGTTGAACTCATCGAAGGCAACATCGCCACGCGCGCC
GAGCGCTACAACATTCCGTGGATCATGATCCTCAACGAGGGCGACGATCCGCGTCCGCTGCCAATCGCCC
AGGCGGGCGTGGCGAGCGTCCTCGGCGCCGACGCGGCGAGCCCCGCGGCCACGCAGGGCATCTCGTGGCA
CTTCTTCGATCGCGGCATCGTGGTGGACATCAAGGCGGCCTATCTGGGCTCGCCAGACGATGATGGCGAC
GGTAAGCCATGGGACGAATTTCTGAGCCTGTGCCGCAATTATCGCCAGCAGCGTCCGTTCGACTCGGTGG
TCATCACGGTGCCGGCCGCTACTCTGCTGGCTGACGATACCGACGCACGCCTCGAGCTCGTACGCCACGC
GAAGCTCGCGCACCGCCGCCTGTGGCTCGCGCAGAATCGCTTTGCGATGCGCTTTGCCGTGTACGTGGTG
GTGACCGGCTGCGAGTCGTTACCGGGCTTCGCGACGTTCGCTCGCGCGCTGCCCGAGCCGCTGCGCGCGA
GCATGCTCGGCTGGTCTTCGCCTTACGATCTCTCGACCACCTACCAGCCAGGCTGGGTCGGCACGGCGAT
GAACAGCATCATGCGCTCGGTCTCGGACGCGAGCGCCGAGTTGTTCGCGCTCGATTCCTCGCACCTCGAT
GCGCGCCAGTTCCTGCAACTGCCCTCGCGCATCGACGCGATGCGCGCTCAGCTTCAGCTTTACGTCGACG
AGCTGCTGCGCGCGAGCGCGTATCACGAGCCGTTCTTCTTCCGCGGCATTTACCTGACCGGAGATGCGAG
CGAATTCGCGCAGTGGAGCGTGACGCAGGCCACCAAGCCGACGGTGGAGGGTGACGCACTGTCCGCGCTC
GAAGCGCCCTCCGGCGAGTCGCACGACGCGCTGACGGCGTATGCGGGGAGCGGCTCTCTCCATGCAGCGG
AAAATATGCACAGCGCGGAGATGGGCGACGGCCGGCGCGAGCCTGGCGGCCAGTTCAACGATCTGATGCT
GCAGCCGGCATTCCTGCGCGATCTGTTCGAGAAAAAGATCTTCCTCGAATACGGCCTCACGCGGCCTTCC
CGTTCGCAGCACCTCACGCGTCCCGTGCTCAACCGCGCCCTACGCTGGGGCGGCATTGCTCTGCTGGGAG
GCTGGGGGCTCGGGCTCGTCATCGCGACGGTGCAGCTTAGTCATCGCAACGGCGAGCTGGTCGCGGCACT
TGGCGCCCTGCGGCGCGACTCGGCTGAGCGAGCGAACGCCGCGCAGCAAGGCCAGGATCTGCCCGCCGAC
TGGTATCGCCGCAAGGCGCTCGCGTTGATCGCGATGAACCAGAACCTCAGGACGAGCAGCGGCTGGACGA
TCTTCATGCCGGGCTCGTGGGGCTTCGTCGATGACCTGAACGCACGCGTGAAGGATCGCTTCGAGCGCGA
GTTCGGCGAGATCGCCGTCGCCGCACTGGAGCGCGAAATGTACGCGCACGTTAGCCAGCTCACGGGCGTG
GGGCGCGATCCAAGCTCGGGTCAGCTCATCATCGGCGACGACTGCACGGCGCCCGATGCTGGCCGCGTCG
GCGCGCCGCTCGGTCTTGCGGTCGACGATCTGCCGCAGATGCACGCCCTCCAGCTCTATGTGCACAACGT
CGATCAGCTCGACGCCGCGCTGCAGGCGCTACAGCGATTGCAGCAACCCGCGCCCGACAACGCGGACTCG
TTGCGGCTCGTGGTGCGCTACGCGCTCGGCGCGGACCTTCAGGGCAACGTGGCGGGCAGCGTGCCTTACT
TCTACCGCGATCAGGACCGCCGCAGCGTAACCGGCAACGGTACGGCCGGCGTCAATCTCGCGGCCGTGCA
GCAGGCGCTGCGCTGCACGCTCGACAAGGGCGCGCAGCAACTCGACGCCGCCATGTTCACGGGCAATCCA
CTGCTGGTCGCGGAGCGCTCCATCTCCGATCGACTGGGTAGCCTCACCGTAGCCGACTCGGGCGCAGGCG
ACTTTACGAAGCTCACGGACGGCTATCGCGCGGTGGTGGCAGGGATCGACACGCAGCGCGACCTGCTCGC
TTCGGGTAAAGGCGGGTGGATTCACCAGACGCAATTCACCCCGGGGCCGACGTACGACCGCACGCTCGCG
CACGTGGCGCAGAGCCGCCTGCTCGGCGCTGACCTCGCGGCGCAGATTCGCCACCGCGACGACAGCGCTT
TCCAGGCCTTCCGCAGCGAGTTTGCGCTGCGCTTTGGCAGTGCGGACAGCGGCATCGTCTGGATCGACAA
GGACGCGCGCTACAGCATCTCGCCGGCCCGGGCCGCATTGCGCGACGGCTTGTCGGGGCTGTTGAGTCAA
CCGTTCATGATCGCGCCGCGCAACCGCGAATTGCCCACCCTTACCGACGGCTCGACGATCGTGTGGGACC
GCGCACAGCTCGACCAGGCGCTCGCGTTGGGCGACGTGCGCAAGCGTTTCCTCGCCGAGGGTCTTGCGAA
TCTGCCGGCGGCGGCGCGCCCCGGCATCGAGACCGCACTCGATCTCCAGTTCGCGCGTCTGATTCTCGAC
CAGACCGCGGCGGCCGCAAACGTGACCACGGCGCCGGCCGACCTCGACAGCGCAGCGTTCGAGGCGGCGC
GCGCGCGACTCACGCGTATCGACGCGCTGCTGACTGAGCTTCACGCGAACGCGCAACTGGAGGATATCGA
CACGCTCGTGTCGAACGACGCCATGGCGCACCTGCGCCGCGTGGACGACGCGCTCACGCAATCCGAGCTG
TACGCGACGCGCCAGGACGTGAGTGCCGACAGTGCGCACAACTCGCGCTCGCCGATTCTCGCGGCGTTCG
GCGTGGCCGATGCGGCCGCGCTCGCGCCGTATCTCGACCAGCAGTCGTCGCGTGCGCTGATGCTCGGCAA
ACAGGCTTCGGTGTATCTCGCCGCGCTCGATCCGAGCGGCGCCGCTTCGCCGCTCGCGCAGCGCTGGCAG
GCGATCAACCGCGACCTGGAGCGCTATCGCCTGAAGAACCCGAACAGCAGCCTGTTGCGTCTCGAACAAT
TCGCGCTCTCGGTGGCGGCCGATCCCGGGCCGGCGGGCTGCATGTCGAAGTTCACCGGCCGGCCCACCAC
GAACGGCGGTGATGACTACTTCGCCACGCTGCACGCACGGCTGTACGATCGCCTGCTCGCGCGTTGCAGC
CAGGGTTATGTGTTCGACATGCGTCGGCAGTGGGGCAATTTCGCCACGGCGTTCAACGAGAGCGTGGCAG
GGCGCATGCCGTTCGACAACGGCGACATGCTGCGCGTGGCCACGCGTAATAGCGGCATGCCGGGGGTGGC
CGACTTCGGCGAACTGGGGCAGGTGCTCAAGCGCTACGAGCCGGTCTCGGAGACGTTCCATGCGTCGGGT
GCGGGTGCCTCGTCGGCGATGACGAACTACAAGGTGCGCCAGTTCATCGAGAACTTCGACCAGGTGAAGA
CGCTGCTCGCGCCGCTCTATCCGTCCGACGATGGAGCGGCCACCGGCTACGACGTGAACGTCGAGTTTCG
CGCGAACCGGAACGGCGAAGTCGCGGCGAACCAGATAATCGACTGGACGCTCACCATCGGCTCGCAAAGC
CTGTCGATGAATGAAGCGCCACACGCGCTGCACTGGGACTTCGGCACGCCCGTCTCGCTCGTGCTGCGCT
TCGCGAAGGACTCGCCGCTGGCGGCGGCAGAGGACGCACAGCAGCGCGCCTACTCGACGGATGGGCGCAC
GCTCACCTGGCAGTTCTCCGATCCGTGGGCGCTCATCACGTTCATCAATCGCCAGCGCGCGGCCGACGCC
AGCGGCCGCGGCGAACGCGCTTCGCAACTGCTGAAAATCGAGTTCCCGCTGGGCACGGCGAACCCCGCCG
ACCTTTCGTTATTGCCGAAGCAGGCCCATGGGCGCGTGTATTTGCGCATCGCGCTGATGCCCGCCGGCAA
GAAGACACCGCTGCCGTGGCCCGGCAGCTTCCCGGTGCGCGCGCCGGAATGGAGCGCACTATGA
 Primer design