SecReT6
Protein ID: 295701009
SecReT6 ID493
T6SS typei4a
Gene symbol-
Locus tagBC1002_5463
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]2477302..2478444 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDD5WG15
KEGG IDbge:BC1002_5463
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.50E-23, Aligned region: 68..128
Protein Sequence: 380 a.a.     [Download]
>gi|295701009|ref|YP_003608902.1| type VI secretion-associated protein, ImpA family [Burkholderia sp. CCGE1002]
MKQAFPMDVELGLHVDFDALLAPVPDSEDGAGVSLRYDPVYQQIREARHQDDASVPMGEWERPLVKADWK
RVAALSSDALATRSKDFQLAAWLCEAWTNLHGVEGLMTGTRLLTALVERYWSSAWPMLEAGDADARVAPF
VWLNDTLALVLTLHVPLLVIDEREPAQVNLDEWQRVVLDGGDAGAANLTRDLLDKHVKRGRNLPALVSLH
RQLELARAAWGNFGHLLDELLLDDSPHLGRVDDVLMRLTRAVSSLCGSQALSAAPQTIAADDAGENSARA
SSAATHLASMENAMSHATLELPSPIAAIRSSPARVESRAQAYDLIELVASYLAEHEPHSPTPYLLRRAVS
WGAMSLPELMREVLRTEGDTSRFFAMLGLE
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|295698848|ref|NC_014118.1|:2477302-2478444 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGAAACAGGCATTTCCCATGGATGTCGAGCTGGGCCTTCACGTGGATTTTGACGCGTTGTTGGCGCCCG
TTCCCGATAGTGAAGACGGCGCAGGCGTTTCGCTGCGCTACGACCCGGTGTACCAGCAGATCCGCGAAGC
GCGCCACCAGGACGATGCGAGTGTGCCAATGGGCGAATGGGAGCGCCCGCTCGTCAAGGCCGACTGGAAG
CGCGTCGCGGCGCTGAGCAGCGACGCTCTCGCGACGCGCAGCAAGGACTTTCAGCTCGCCGCGTGGCTGT
GCGAGGCATGGACGAATTTGCATGGTGTCGAAGGCCTGATGACTGGGACACGCTTGCTGACGGCACTCGT
CGAGCGTTACTGGTCGAGCGCATGGCCGATGCTCGAAGCCGGCGATGCCGATGCACGCGTAGCGCCGTTC
GTCTGGCTCAATGACACGCTGGCTCTCGTGCTGACGCTGCACGTGCCGTTACTTGTCATCGACGAGCGCG
AGCCGGCGCAGGTCAACCTCGACGAGTGGCAGCGTGTCGTGCTGGACGGCGGCGATGCCGGGGCGGCGAA
CCTCACACGCGATCTACTCGACAAGCACGTGAAGAGGGGGCGCAACCTTCCTGCGCTCGTATCGCTTCAT
CGACAACTGGAACTGGCGCGAGCGGCGTGGGGGAATTTCGGGCATCTGCTCGATGAATTGCTGCTAGACG
ACTCGCCGCATCTTGGCCGGGTCGATGACGTTCTGATGCGTCTGACACGCGCCGTGAGCAGCCTGTGCGG
TTCTCAGGCGCTATCCGCCGCGCCGCAGACAATCGCGGCGGACGACGCCGGCGAAAACTCCGCGCGTGCG
TCAAGCGCGGCTACACACCTCGCATCGATGGAAAACGCCATGAGCCATGCCACGCTGGAATTACCGTCGC
CGATCGCTGCTATCAGGTCTTCGCCCGCGAGAGTGGAAAGCCGCGCGCAGGCCTATGACTTGATCGAACT
CGTGGCCAGTTACCTGGCCGAGCACGAGCCGCATAGCCCGACTCCGTATTTGCTGCGACGCGCGGTGTCA
TGGGGTGCGATGTCTCTACCGGAGCTGATGCGCGAGGTCTTGCGCACAGAAGGGGATACCTCACGATTCT
TTGCGATGCTCGGACTCGAATAA
 Primer design