SecReT6
Protein ID: 296101898
SecReT6 ID395
T6SS typei3
Gene symbolimpL
Locus tagECL_01536
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1555111..1558731 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDD5C6F0
KEGG IDenc:ECL_01536
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.40E-99, Aligned region: 208..483
ImcF-related_N [PF14331], Evalue: 3.40E-99, Aligned region: 760..818
ImcF-related_N [PF14331], Evalue: 3.40E-99, Aligned region: 862..893
IcmF-related [PF06761], Evalue: 8.20E-93, Aligned region: 531..836
DUF1215 [PF06744], Evalue: 1.30E-29, Aligned region: 947..1072
Protein Sequence: 1206 a.a.     [Download]
>gi|296101898|ref|YP_003612044.1| type VI secretion system protein ImpL [Enterobacter cloacae subsp. cloacae ATCC 13047]
MLTTLLSILTNRILWSFLGVTALSAVIWMIGPLLSIVDTRPLESEQNRIISIAVVYLLWAQGHILPRLYN
AWLNRKLMDKLNENTAKPDAADPQKRLNSEEQILAGRFDEAAQMLKKAHFSKAGHGAQWTQRFSTQYLYQ
LPWYVIIGAPGAGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQV
QDAGEWLEFIGLLRKYRRRQPINGVIITISISDLLTLSPEAARQQAVNLRQRLSELHEQLGIRFPVYVMV
TKADLLKGFRAWFADYDKAQRDQIWGFTLPWEQTKHADFDLMGNFHQEFSLLQQRLDAGLPETMLKEHDA
KTRAEAYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYFASGTQEGMPFDRVMGELNRALSLPEG
AEAEKWDSVSKEAPIPGAKGQSFFIKNLLQNVIFQEAGIAGENRWWELRNRAVIWSGYAALLALLVILGG
LWLTSYAKNKAYLEEVDAKVPQLEQQSKALQNQPQRDLFALLPLLNSLVDLPKSEAFDVNDPPVSRRMGL
YRGDDVSDASQSLYQKALDQMLLPAVAMHITTWLRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSWV
MLNLQRNLPQNVTQAQLQQLEWHLTQLLEPKIQASPYAQDEALVARERALINQQPLSTRVYGRLKRLLEH
DENLKPVSLSDLGGPQSELVFSRKSGKPVSEGVPGLYTPDGYWKSFNSQIDSVTTALHEDDAWVLGATTS
GEDKQQIDNAVRQLYMRDFIANWDRFLADIQLNNSADLSQRINTARLLSGANSPLRRLVQNLSQVLTLSR
NAPAPEDAGKAQDQSNRATRTLEALFRNNDNAPTQGAVVTQAPEQLVTDHYAPMIELAQPLEKGGKTIVF
DDFLKQVDELYRYLTAVQDAANSGMPAPGGEAISRLQASAGRLPGGLQTMFSNMAVGASSDTQRRDLENV
RKRINVEVGGFCRQAIAGRYPLVRSASTEVTPDDLARMFAPGTGLMDTFFRDNLTNKVDTTQANWRFMPG
IDGKTLPGSEGLLRPFQQAQSIRDAFFANGATTPSFKVTVRTVRMDNTILNLTLDVDGQLLRYSHGPQAV
QIMNWPGPGGTNQVRMQLGLANGSTATLVTNGAWALNRFFDKARTSPGAGSLSRQATFNVDGHQVTLEFA
PNSIRNPFQLPRFSCP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1555111-1558731 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCTGACGACTCTTCTTTCCATACTGACCAATCGCATTCTGTGGAGCTTCCTGGGCGTTACCGCGCTGT
CGGCGGTGATCTGGATGATTGGTCCGCTGTTATCCATCGTGGATACCCGCCCGCTCGAATCTGAACAAAA
CCGCATCATCAGTATTGCGGTGGTTTATCTGCTCTGGGCGCAGGGGCATATTCTGCCGCGGCTCTACAAC
GCCTGGCTGAACCGCAAGCTGATGGACAAGCTCAATGAAAACACCGCCAAACCGGACGCGGCCGATCCCC
AGAAGCGGCTGAACAGCGAGGAGCAGATCCTCGCCGGACGTTTTGATGAAGCGGCGCAAATGCTGAAGAA
AGCCCACTTCAGCAAAGCGGGACACGGTGCCCAGTGGACGCAGCGCTTCAGTACGCAATATCTCTACCAG
CTGCCGTGGTACGTCATTATCGGCGCACCGGGCGCCGGTAAAACCACGGCGCTGGTCAATTCCGGCCTGC
AATTCCCGCTGGCGGATCGCTTCGGTAAAACCGCTCTGCGCGGCATTGGCGGCACCCGCAACTGCGACTG
GTGGTTCACTAATGAAGCCGTCCTGCTGGACACCGCGGGGCGCTACACCACTCAGGAGAGCGAGCAGGTT
CAGGATGCCGGGGAGTGGCTGGAATTTATCGGCCTGCTGCGTAAGTATCGCCGCCGCCAGCCTATTAACG
GCGTCATTATCACCATCAGCATTTCCGATCTGCTGACGCTCTCCCCGGAAGCGGCGCGCCAGCAGGCGGT
TAACCTGCGCCAGCGGCTGTCTGAGCTGCATGAACAGCTGGGTATCCGCTTCCCGGTTTACGTGATGGTG
ACCAAGGCGGACCTGCTTAAAGGCTTCCGCGCCTGGTTTGCTGACTACGACAAAGCGCAGCGCGACCAGA
TTTGGGGCTTCACGCTGCCGTGGGAACAGACCAAACACGCCGATTTCGACTTGATGGGGAACTTCCACCA
GGAGTTCTCGCTGTTGCAGCAGCGTCTGGACGCCGGGCTGCCGGAGACCATGCTGAAAGAGCATGACGCC
AAAACCCGTGCCGAAGCGTATCTCTTCCCGCAGGAGTTCGCGGCGCTGCGCCCGCTGCTGGCAGACTACC
TGAGCACGGTCTTTGCCCGCTCTAACTTTGAGACCGAGTTCTCCCCACGCGGAATATACTTCGCCAGCGG
CACCCAGGAAGGCATGCCGTTCGACCGCGTCATGGGTGAACTGAACCGCGCCCTGTCACTGCCGGAAGGG
GCAGAGGCAGAGAAGTGGGATTCGGTCAGTAAAGAGGCGCCGATCCCCGGTGCAAAAGGGCAGAGCTTCT
TCATTAAAAACCTGCTGCAAAACGTCATTTTCCAGGAAGCCGGTATTGCCGGTGAAAACCGCTGGTGGGA
ACTGCGCAACCGCGCGGTGATCTGGTCCGGATACGCGGCGCTGCTGGCGCTGCTGGTGATCCTTGGCGGA
CTGTGGCTGACCAGCTATGCCAAAAATAAGGCCTATCTGGAAGAGGTGGACGCTAAAGTCCCGCAGCTGG
AGCAGCAGAGTAAAGCGTTACAGAATCAGCCCCAGCGCGATCTGTTCGCGCTCCTGCCGCTGCTGAACAG
CCTGGTCGATCTGCCGAAAAGCGAGGCATTCGATGTCAACGACCCGCCGGTCTCCCGCCGTATGGGGCTC
TATCGCGGGGATGACGTCAGCGATGCTTCCCAGTCGCTGTATCAGAAAGCGCTGGATCAGATGCTGCTGC
CCGCCGTGGCGATGCATATCACCACCTGGCTGCGCAACGACAACGGCAGCGACGTGGAATACAGCTACGA
GGCGCTGAAAGCCTACCAGATGCTGTATCAGCCTAAACACTACGACGGCAAATTCCTGCATTCCTGGGTG
ATGCTCAATTTACAGCGTAATCTGCCGCAGAACGTGACGCAGGCGCAGCTGCAACAGCTGGAGTGGCACC
TGACGCAGCTGCTGGAGCCAAAAATTCAGGCTTCGCCGTATGCCCAGGACGAAGCGCTGGTGGCTCGCGA
GAGGGCGCTCATCAACCAGCAGCCGCTCTCCACCCGCGTGTATGGGCGTCTGAAGCGTCTGCTGGAGCAT
GACGAAAACCTGAAGCCGGTCTCCCTGTCCGACCTGGGTGGCCCGCAGAGCGAACTGGTGTTCTCCCGCA
AAAGCGGCAAACCGGTGAGCGAAGGCGTGCCGGGGCTCTACACCCCGGACGGCTACTGGAAGAGCTTTAA
CAGCCAGATTGACAGCGTGACCACGGCGCTGCACGAAGATGATGCCTGGGTGCTGGGCGCGACCACCTCC
GGGGAAGACAAGCAGCAGATCGATAACGCCGTGCGTCAGCTCTACATGCGCGACTTTATCGCAAACTGGG
ATCGTTTCCTCGCCGACATTCAGCTTAACAACAGCGCCGATCTCTCGCAGCGCATCAACACGGCGCGCCT
GCTCTCCGGCGCAAACTCGCCGCTGCGCCGTCTGGTGCAGAACCTGAGCCAGGTGCTGACGCTGTCGCGC
AACGCGCCAGCGCCGGAGGACGCGGGGAAAGCGCAAGACCAGAGTAACCGCGCCACCCGTACCCTCGAAG
CGCTGTTCCGCAATAACGACAATGCTCCGACGCAGGGGGCAGTAGTGACGCAGGCACCTGAACAGCTGGT
GACCGACCATTACGCGCCAATGATCGAGCTGGCTCAGCCGCTGGAGAAGGGCGGCAAGACCATCGTCTTT
GATGATTTCCTCAAGCAGGTGGATGAGCTGTATCGTTATCTGACCGCGGTGCAGGACGCTGCCAACAGCG
GCATGCCAGCCCCGGGTGGTGAAGCAATCAGCCGTCTGCAGGCCAGCGCCGGGCGTCTGCCGGGCGGGCT
GCAAACCATGTTCAGCAACATGGCGGTGGGGGCCAGCAGTGATACCCAGCGTCGCGATCTGGAAAACGTC
CGTAAGCGCATTAACGTCGAAGTGGGTGGTTTCTGCCGTCAGGCAATTGCCGGTCGCTACCCGCTGGTGC
GCAGCGCCAGCACCGAGGTGACGCCGGACGATCTGGCACGCATGTTTGCGCCGGGTACCGGGCTGATGGA
TACCTTCTTTCGCGACAACCTGACCAACAAAGTGGATACCACTCAGGCGAACTGGCGCTTTATGCCGGGG
ATCGACGGTAAAACGCTGCCGGGAAGTGAAGGACTGCTGCGACCGTTCCAGCAGGCCCAGTCCATTCGCG
ATGCCTTCTTTGCTAACGGTGCGACGACCCCCTCTTTCAAGGTGACGGTGCGTACCGTGCGGATGGATAA
CACCATTCTTAACCTGACGCTGGACGTTGACGGCCAACTGCTGCGTTACAGCCACGGTCCACAGGCGGTG
CAGATCATGAACTGGCCAGGGCCGGGCGGCACCAACCAGGTGCGTATGCAGCTGGGTCTGGCCAACGGCA
GCACCGCGACGCTGGTAACCAACGGCGCCTGGGCCCTGAACCGCTTCTTCGATAAAGCGCGCACCAGCCC
TGGGGCAGGTAGTCTGAGCCGTCAGGCCACGTTCAACGTCGATGGCCATCAGGTCACGCTGGAGTTTGCG
CCGAACAGCATTCGCAATCCGTTCCAGCTTCCTCGTTTCTCATGCCCATAA
 Primer design