SecReT6
Protein ID: 296102172
SecReT6 ID396
T6SS typei2
Gene symbolimpL
Locus tagECL_01813
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1834869..1838342 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDD5C7Y8
KEGG IDenc:ECL_01813
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.20E-72, Aligned region: 432..750
DUF1215 [PF06744], Evalue: 8.00E-35, Aligned region: 873..993
Protein Sequence: 1157 a.a.     [Download]
>gi|296102172|ref|YP_003612318.1| type VI secretion system protein ImpL [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKLPFAFAPKTTEGRYLAVTLIFFLLLAAMTFMVWKHPDIAGIQYGSQQQTYWLIAGGCISGCTLIMLVV
HLWAALSAGKKEFDALVANVSGDDEKKKRENDNDPVHPAVVMCDRIRAHLRSRISLYWRSKTRLLLITGD
EAAIEQLVPGLQQQQWLEGNRTVLIYGGSLASEPDREKYIALRKLRRGRPLDGIIRVLPQSLKLTPQISD
NDLRGLEKISELLRYSAPVWLWQLCGSNWSQDTRPEQAVGASFPLRANEGDVIRQLERMLPALRTQGMSQ
VSENNRHDFLLRLGQHLQDGGIVRWTEQLVPWLAASRQRVPLRGLMFSLPEKKTAGTSASTADAEQYIPG
SQRHALTLPAIWQGTVDDCPRVRGRRVGMAWEQTLAWTLMAIIGVWGAGTLLSFAVNRSQIVSVAQQAHA
LVEHPSVSDYQLTALHTLRNDAGRLQHRIQDGAPWYQRFGLDHNQQLLDAMLPWYGVANNRLIRDPANEA
LKQKLSALANYAPNSDQRARLAKPGYDQLKAWLMMARPDKADGAFYAQTMKTVQPTRMGISAGLWQSLSP
DLWAFYISELPAQPQWKITPDAQLVSQGRQVLLQQIGRRNAESTLYENMLKSVRRNFADVSLEDMTGGTD
ARRLFTTDEVVPGMFTRQAWEGGIQQAIEKAANSRRDEIDWVLSDSRKAVSSDLSPEALKARLTQRYFTD
FAGSWLSFLNSLQLNPANNIADVTDQLTLMSDVRQSPLIALMNTLAWQGQTGQQREALSDSIIKSAKDLV
GGKDKPAIDQSASGPQGPLDDTFGPLLQLLGKNKGSNVMSADNSLSLQTYLTRITRVRLRLQQVASASDP
QAMMQTLAQTVFQGKSVDLTDTQQYGSLISASLGEEWSGFGSTMFVQPLTQAWETVLQPSAASLNDKWSR
SVVANWHTAFDGRFPFAASKSDASLPMLAEFVRKDSGRIERFLTTELGGVLHKEGSQWVPDKVNSQGLSF
NPSFLRAINQLSQLSDILFTDGSQGISFELQARPVPQVVETQLTVDGQKLHYFNQMADWQSFRWPGDTYK
PGTMLTWTTVNAGARLFRDYSGTWGFIRWLDQGKCAQLDRSQWMMSFTAPDGRTLQWVLRSQLGSGPLAL
LALRGFTLPDQIFSVDSAATAQALMDSTESSDMDGTE
 
Nucleotide Sequence: 3474 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1834869-1838342 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
GTGAAGCTACCTTTTGCTTTTGCACCGAAGACTACGGAAGGCCGCTACCTTGCTGTCACATTGATTTTCT
TTTTGTTGTTAGCCGCTATGACGTTCATGGTCTGGAAGCATCCGGATATTGCCGGGATTCAGTACGGTAG
TCAGCAGCAAACTTACTGGCTTATCGCTGGCGGATGTATTTCAGGATGCACACTTATCATGCTGGTTGTG
CACCTGTGGGCTGCTCTCAGTGCCGGTAAAAAGGAGTTTGATGCGCTTGTCGCCAATGTCAGTGGTGATG
ATGAGAAAAAGAAACGGGAAAATGATAACGACCCTGTTCACCCTGCGGTGGTCATGTGTGACAGGATTCG
GGCGCATCTCCGCTCCCGTATTAGTCTTTACTGGCGCAGCAAAACCCGTCTGCTGTTAATCACTGGCGAT
GAGGCGGCCATCGAACAACTGGTACCCGGCCTGCAACAGCAGCAGTGGCTTGAAGGTAACCGCACCGTGC
TGATTTACGGCGGCAGCCTGGCATCGGAGCCCGACCGCGAAAAATACATCGCGCTGCGCAAGCTGCGACG
CGGACGCCCGCTGGACGGGATTATCCGTGTACTACCGCAGTCGCTTAAGCTGACCCCGCAAATCAGCGAC
AACGATTTACGCGGGCTGGAAAAAATCAGCGAACTGCTGCGCTATTCCGCCCCGGTCTGGCTGTGGCAGT
TGTGTGGCAGCAACTGGTCGCAGGATACGCGTCCTGAGCAGGCGGTAGGCGCAAGCTTTCCTCTCCGCGC
AAACGAAGGCGACGTGATCCGCCAACTCGAGCGGATGCTGCCGGCGCTGCGGACGCAGGGGATGAGTCAG
GTCTCCGAAAACAACCGCCACGACTTCCTGTTGCGCCTGGGCCAGCATCTCCAGGACGGCGGTATCGTCC
GCTGGACTGAGCAACTGGTGCCATGGTTGGCTGCCTCCCGGCAGCGCGTTCCCCTGCGGGGGCTGATGTT
CAGCCTGCCGGAGAAGAAAACTGCCGGTACGTCAGCGAGCACAGCCGACGCTGAGCAATATATTCCGGGG
TCACAGCGTCATGCACTGACCCTGCCGGCAATCTGGCAGGGTACCGTTGACGACTGCCCCCGCGTTCGTG
GCCGCCGTGTCGGTATGGCGTGGGAGCAGACGCTTGCCTGGACGCTGATGGCCATTATCGGTGTCTGGGG
GGCGGGAACGCTGCTGTCGTTCGCGGTTAACCGGTCACAGATAGTCTCTGTTGCGCAGCAGGCGCATGCA
CTGGTGGAGCACCCTTCCGTATCGGATTACCAGCTGACGGCCCTGCATACCCTGCGCAATGATGCCGGCC
GCCTGCAGCACCGTATCCAGGACGGAGCGCCCTGGTATCAGCGCTTCGGCCTCGACCATAATCAGCAGCT
GCTTGATGCGATGCTGCCCTGGTACGGCGTGGCAAACAACCGCCTGATACGCGACCCGGCAAATGAGGCG
CTTAAGCAGAAGCTCAGCGCGCTGGCAAATTATGCCCCCAACAGTGACCAACGGGCACGACTGGCGAAAC
CGGGCTATGACCAGCTGAAAGCCTGGCTGATGATGGCTCGTCCGGATAAAGCCGACGGCGCATTCTACGC
GCAGACCATGAAAACCGTGCAGCCGACGCGAATGGGTATCTCAGCAGGCCTGTGGCAAAGCCTGTCACCG
GATTTGTGGGCTTTTTATATATCCGAACTGCCAGCGCAGCCACAGTGGAAAATCACGCCGGATGCGCAGT
TGGTCAGCCAGGGCCGCCAGGTGCTGCTGCAGCAGATAGGACGGCGCAACGCGGAAAGCACGCTGTACGA
GAACATGCTCAAATCCGTGCGCCGTAACTTTGCCGATGTGTCTCTGGAGGACATGACTGGCGGTACCGAT
GCCCGTCGCCTGTTTACCACCGATGAGGTGGTACCGGGAATGTTCACCCGTCAGGCCTGGGAGGGGGGGA
TTCAGCAGGCTATCGAAAAGGCCGCAAATTCCCGCCGCGATGAAATCGACTGGGTACTGAGCGACAGCCG
AAAAGCCGTCTCCTCAGACCTGTCGCCGGAAGCACTGAAAGCGCGTCTGACACAACGCTACTTCACTGAC
TTTGCTGGCAGCTGGCTGAGCTTCCTCAACAGCCTGCAACTTAATCCGGCGAACAACATAGCGGATGTCA
CAGACCAACTGACGCTGATGAGCGATGTCCGCCAGTCACCGCTGATCGCCTTGATGAATACCCTCGCCTG
GCAGGGACAGACCGGACAGCAGCGCGAAGCTCTTTCGGACTCCATCATCAAATCGGCTAAAGATCTCGTA
GGTGGAAAAGATAAGCCTGCGATTGATCAGTCTGCGTCAGGACCGCAGGGGCCGCTGGATGACACCTTTG
GACCGTTGCTTCAGCTTCTGGGTAAAAACAAGGGCAGCAACGTCATGTCGGCTGATAACTCCCTGAGCCT
GCAGACGTACCTGACCCGTATCACCCGCGTGCGTCTACGCCTGCAACAGGTGGCTAGCGCCTCTGACCCG
CAGGCGATGATGCAGACCCTGGCGCAGACCGTATTCCAGGGCAAAAGCGTGGACCTGACCGACACCCAGC
AATACGGCAGTCTCATTTCTGCAAGTCTTGGCGAAGAGTGGAGTGGTTTTGGCAGCACGATGTTTGTGCA
GCCTCTGACCCAGGCATGGGAAACCGTGCTTCAGCCGTCGGCAGCGAGCCTCAATGACAAGTGGAGCCGC
TCTGTGGTGGCGAACTGGCACACCGCATTTGACGGTCGTTTCCCGTTTGCCGCGAGTAAAAGTGATGCCT
CCCTGCCGATGCTGGCTGAATTTGTGCGTAAGGACAGCGGACGTATTGAACGCTTCCTGACGACAGAGCT
CGGTGGTGTTCTGCACAAGGAGGGCAGCCAGTGGGTGCCGGATAAAGTCAACAGCCAGGGGCTGAGTTTT
AACCCGTCCTTCCTGCGGGCGATTAATCAGTTGAGTCAGTTGTCGGACATTTTGTTTACCGACGGCAGCC
AGGGTATCAGCTTCGAACTGCAGGCGCGTCCGGTACCGCAGGTGGTGGAGACGCAACTGACTGTTGATGG
ACAAAAGCTGCACTACTTTAACCAGATGGCTGACTGGCAGTCCTTCCGCTGGCCGGGAGACACGTACAAG
CCGGGAACCATGCTGACCTGGACCACGGTCAACGCGGGTGCGCGTCTGTTCAGGGATTACAGCGGAACCT
GGGGCTTTATTCGCTGGCTGGACCAGGGCAAGTGTGCGCAGCTTGATCGCAGTCAGTGGATGATGAGTTT
CACCGCGCCGGATGGCCGTACCCTGCAGTGGGTGCTGCGTTCACAGCTGGGCAGCGGGCCGCTGGCGTTA
CTGGCACTGCGCGGCTTCACGCTGCCGGATCAGATATTCAGCGTCGACAGCGCGGCCACGGCGCAGGCGC
TGATGGACAGTACGGAAAGCAGTGATATGGACGGAACGGAATAA
 Primer design