SecReT6
Protein ID: 296273271
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1741
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1735158..1736636 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDD5V1G1
KEGG IDant:Arnit_1741
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.20E-13, Aligned region: 45..104
Protein Sequence: 492 a.a.     [Download]
>gi|296273271|ref|YP_003655902.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MNHLVLNQINSSLICGQDCKYDDSFLLIEQEIDKTYSVNQEEETNWEYVVENCEKILLEKSKDIKVSSWY
LYGLIKQNSFNNFENSLRIYIKLLETFSTQMHPKSLKAKRNIFLWLEELLTNDLLNNIAKINKEDFLQYY
TYFIRLDTVIKMILENDSESFFKKIIKYFEENKIKKLTQTTSNNKISSTNEQEIKEITNKDEALKVMRNF
KKYALMLTKYYRSNNISDLKALRITRLLSFLEIEGLPPSENNITHLNPPSILEINEIEDNYKNKNYEEAF
LLVEEILEVCPFWLDGHYYAFNILEKTNNNIESFEAKKTFLNFIEINENIEKLYFNDETPFASNKVKNWL
KENLINKLEEPKNLLVQSTKDKDDLDKAYKLAEENKIKDAMKLLEGNYNYASSFEDKFNWRLNHAKLSLQ
YNKNDIALVLLEDLEKEIDRFYLYEWNPKLAANVYTLILSSFNNTDIDTEKINTIYNKLCKIDINSAYEL
KI
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1735158-1736636 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
TTGAATCATTTAGTTCTTAATCAAATAAATTCTTCTTTAATTTGTGGTCAAGATTGTAAATATGATGACT
CATTTTTATTAATAGAACAAGAAATAGATAAAACATATAGTGTAAACCAAGAAGAAGAGACAAATTGGGA
ATATGTAGTAGAAAACTGTGAAAAAATTTTATTAGAAAAGTCAAAAGATATAAAAGTTTCTTCATGGTAT
TTATATGGACTTATTAAACAAAATTCTTTTAATAATTTTGAAAATTCTTTAAGAATTTATATTAAACTTT
TGGAGACTTTTTCAACTCAAATGCATCCAAAATCTTTAAAAGCAAAAAGAAACATTTTTTTGTGGCTTGA
AGAATTACTTACTAATGATTTACTAAATAATATAGCAAAAATCAATAAAGAAGATTTTTTACAATATTAT
ACTTATTTTATTAGACTAGATACAGTTATCAAGATGATACTAGAAAATGATTCAGAAAGTTTTTTTAAAA
AGATAATTAAATATTTTGAAGAAAATAAAATAAAAAAACTTACTCAAACAACTTCTAATAATAAAATCAG
TTCTACAAATGAACAAGAAATAAAAGAAATAACAAATAAAGATGAAGCTTTAAAGGTTATGAGAAATTTT
AAAAAATATGCTTTAATGCTAACAAAATATTATAGAAGTAATAATATTTCTGATTTAAAAGCTTTAAGAA
TCACAAGACTTTTATCTTTTTTAGAAATAGAAGGCTTACCTCCATCAGAAAATAATATTACACATCTAAA
TCCACCTTCAATATTAGAGATAAATGAAATAGAAGATAATTATAAAAATAAAAACTATGAAGAGGCTTTC
TTATTAGTTGAAGAGATTTTAGAGGTTTGTCCTTTTTGGTTGGATGGCCATTATTATGCTTTTAATATTT
TAGAAAAAACTAATAACAATATAGAATCTTTTGAAGCAAAAAAAACTTTCTTAAATTTTATAGAAATAAA
TGAAAATATTGAAAAATTATATTTTAATGATGAAACTCCTTTTGCCTCAAATAAAGTAAAAAATTGGTTA
AAAGAAAATTTAATTAATAAGCTTGAGGAACCTAAGAATTTATTAGTTCAAAGTACAAAAGATAAAGATG
ATTTAGATAAAGCTTACAAATTAGCCGAAGAAAATAAAATAAAGGATGCGATGAAACTATTAGAAGGAAA
TTACAATTATGCTTCATCTTTTGAAGATAAATTTAACTGGCGTTTAAATCATGCAAAACTATCTTTGCAA
TATAACAAAAATGATATTGCTTTAGTTTTATTAGAAGATTTAGAAAAAGAGATTGATAGGTTTTATCTAT
ATGAATGGAATCCAAAGTTAGCTGCAAATGTTTATACTTTAATTTTGAGTTCTTTTAATAACACAGATAT
AGATACTGAAAAAATAAATACTATTTATAACAAGCTATGTAAAATTGATATAAATAGTGCATATGAACTT
AAAATTTAA
 Primer design