SecReT6
Protein ID: 296273272
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1742
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1736648..1737136 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDD5V1G2
KEGG IDant:Arnit_1742
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-49, Aligned region: 4..157
Protein Sequence: 162 a.a.     [Download]
>gi|296273272|ref|YP_003655903.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MNKQSESPKERINVTYKPATGDVQEDVEIPFKITLLGEYNPNEEKKPVEEIKAIKVDKNNFNDVLKGQNL
SVSFNVENKLVKEEDSSLGVNLKINTIKDFSPENVVENVPEMKVLMELRKSLMALKGPLGNVPAFRKAIE
SAIYNKEERDKLMSELNLDSKE
 
Nucleotide Sequence: 489 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1736648-1737136 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAATAAACAATCAGAATCACCAAAAGAGAGAATTAATGTCACTTATAAACCAGCAACAGGGGATGTTC
AAGAAGATGTAGAAATTCCTTTTAAAATAACATTATTAGGTGAATATAATCCAAATGAAGAGAAAAAACC
AGTTGAAGAAATAAAAGCAATAAAAGTTGATAAAAATAATTTTAACGACGTATTAAAAGGACAAAATTTA
TCTGTCTCTTTTAATGTTGAAAATAAATTAGTGAAAGAAGAAGATAGTTCTTTGGGGGTGAATTTAAAAA
TTAACACAATTAAAGATTTTTCACCAGAAAATGTCGTTGAAAATGTTCCTGAAATGAAAGTTTTAATGGA
ATTAAGAAAATCATTAATGGCATTAAAAGGCCCACTAGGTAACGTTCCTGCATTTAGAAAAGCAATTGAG
AGTGCTATTTATAATAAAGAGGAAAGAGATAAATTAATGTCTGAATTAAATTTAGATTCAAAAGAATAA
 Primer design