SecReT6
Protein ID: 296273273
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1743
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1737146..1738621 [+]
Producttype VI secretion protein
NoteTssC
UniProt IDD5V1G3
KEGG IDant:Arnit_1743
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.30E-181, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|296273273|ref|YP_003655904.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MSTNEVLEQNNVSTTNSLLDAIVAQTKLTQDDDTYDVVKSGVGALIEELISSNNNEEKVNKSVIDKMIAE
IDKKISSQMDEILHNKQFQALESKWRGLYMLVERTDFRQNILMEFINVSKEDLIEDFEESLDITQSGLYK
HVYSSGYGQFGGEPVGTIIADYELSPSNVDIKFLNKVAAISAMAHAPFIGAAGPKFFGLNSFEGLPDLKD
IEDVMSSPQFAAWRGFRKNEDSRYVGLTLPRFLLRAPYDPEDNPISNFVYKEDVSKDHENYLWGNTVYAF
ASKLTDSFASFRWCTNIIGPKSGGEVKDLPVHTFESMGDIEMKIPTEVLVSDRREYELSEQGFIPLIMRK
GSNTAAFFAASSAQEPKIFPNTPEGNEAQLNYKLGTQLPYLYAITRMSHYIKVLQREHIGSWRERADLER
ELNRWAKQYVANQENPTAEIRSKRPFKDIAINVEDVSTDPGWYKVRISLRPHFKYMGASFELSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1737146-1738621 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGTCAACGAATGAAGTTTTAGAACAAAATAATGTAAGTACTACAAATAGCTTATTAGATGCAATTGTTG
CACAAACAAAATTGACTCAAGATGATGATACATATGATGTAGTTAAATCAGGAGTAGGGGCTTTAATAGA
AGAACTTATAAGTTCAAATAATAATGAAGAAAAAGTTAATAAATCAGTAATTGATAAAATGATTGCAGAA
ATTGATAAAAAAATATCTTCTCAAATGGATGAAATATTACATAATAAACAATTCCAAGCATTAGAATCAA
AATGGCGTGGGTTATATATGTTAGTTGAAAGAACAGATTTTAGACAAAATATTCTTATGGAATTTATTAA
TGTTTCGAAAGAAGACTTAATTGAAGACTTTGAAGAGAGTTTAGATATTACACAATCTGGTTTATATAAA
CACGTTTATTCATCAGGATATGGTCAATTTGGTGGAGAACCAGTTGGTACTATAATTGCAGATTATGAAT
TATCTCCATCAAATGTTGATATTAAGTTTTTAAATAAAGTTGCAGCAATTTCAGCAATGGCACATGCTCC
ATTTATAGGAGCAGCTGGTCCTAAATTTTTTGGACTAAATAGCTTTGAAGGTTTACCTGATTTAAAAGAT
ATAGAAGATGTAATGAGTTCTCCTCAGTTTGCAGCATGGAGAGGATTTAGAAAAAATGAAGATTCTAGAT
ATGTAGGTCTTACTTTACCTAGATTTTTACTAAGAGCACCTTATGATCCAGAAGATAATCCTATTTCAAA
TTTTGTTTACAAAGAAGATGTATCAAAAGACCATGAAAATTATTTATGGGGAAATACTGTTTATGCATTT
GCAAGTAAATTAACTGATAGTTTTGCAAGTTTTAGATGGTGTACAAATATTATTGGTCCAAAATCAGGGG
GAGAAGTAAAAGACTTACCTGTTCATACTTTTGAGAGTATGGGAGATATTGAAATGAAAATTCCTACAGA
AGTTTTAGTTTCTGATAGAAGGGAGTATGAGTTATCTGAACAAGGTTTTATTCCTTTAATTATGAGAAAA
GGAAGCAATACTGCTGCTTTTTTTGCTGCAAGTTCTGCTCAAGAACCGAAGATTTTCCCAAATACTCCAG
AAGGGAATGAAGCTCAATTAAATTATAAATTAGGAACTCAATTACCATATTTATATGCAATTACAAGAAT
GTCTCACTATATCAAAGTTTTACAAAGAGAACATATTGGTTCGTGGAGAGAAAGGGCTGATTTAGAAAGA
GAACTAAATAGATGGGCTAAACAATATGTTGCAAATCAAGAAAATCCTACTGCAGAAATTAGAAGTAAAA
GACCATTTAAAGATATTGCAATTAATGTAGAAGATGTAAGTACTGATCCAGGTTGGTATAAAGTAAGAAT
TTCTTTAAGACCTCATTTTAAATATATGGGTGCAAGTTTTGAATTATCTTTAGTTGGAAAGCTAGATAAA
GAATAA
 Primer design