SecReT6
Protein ID: 296273274
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1744
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1738623..1739039 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD5V1G4
KEGG IDant:Arnit_1744
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-12, Aligned region: 26..112
Protein Sequence: 138 a.a.     [Download]
>gi|296273274|ref|YP_003655905.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MYSGSLFERLSSSFNPNDYDNEDEAVYASIANNLSKMFSTNAGSSEIAKDYGRPDLNNIDFSMNDSIEII
EKKSELCIKKYEPRLYKAKVAVSKKKLILNEMNIYIEGHVFINGKTKKINYRADLLKNGKVKIYKDGI
 
Nucleotide Sequence: 417 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1738623-1739039 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGTATAGTGGCAGTTTATTTGAAAGATTATCTTCTAGTTTTAATCCTAATGATTATGATAATGAAGATG
AAGCAGTATATGCATCAATTGCAAATAATCTATCAAAAATGTTTTCAACAAATGCTGGAAGCTCAGAAAT
AGCAAAAGATTATGGGCGTCCAGATTTAAATAATATTGATTTTAGTATGAATGATTCCATTGAAATTATT
GAGAAAAAATCAGAATTATGTATAAAAAAGTATGAACCTAGACTTTATAAAGCAAAAGTTGCTGTATCAA
AAAAGAAACTAATTTTAAATGAAATGAATATCTATATAGAAGGTCATGTATTTATTAATGGAAAAACTAA
AAAAATCAATTATAGAGCAGATTTATTAAAAAATGGTAAAGTGAAGATATATAAAGATGGCATTTAA
 Primer design