SecReT6
Protein ID: 296273275
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1745
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1739029..1740801 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDD5V1G5
KEGG IDant:Arnit_1745
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.50E-154, Aligned region: 3..589
Protein Sequence: 590 a.a.     [Download]
>gi|296273275|ref|YP_003655906.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MAFNDYYKEELITLRNDGAEFSKKNPGLSTYLSKEGQDPDVERLLEGFSFLTGRLKQNLNEELPEVAHTL
VQLLWPNYVKPIPSYSIIQYDSIKDSTENSHIKKHTEVLSKINSSKTQCKFRTIYDIDIMPFMLKNINYF
IHGKKSTLELNMDMTASGTLKNLVFKDLRVYLSGSKFIAQNLYLFLTKFIERIEISINNVDNKSIYNINI
DNNSITPVSFDLRNNMTPYSSNLFDGYILLQEYFSYKDKFLFLDFKNLSKIESIPHEILENSKNFTIKIE
FRESLSRSEIPDKSNFSLYCTPIINLFETDSIPIRKNEEIEEFLVVPSDLNKDACEVFSIQNVRGWISNK
KTYQDYLPFESFEHIDEENEYYSSRVKLTSDGKRTNTYLRFSTAKGRENNFLTSNSTVSVKILCTNLNIP
STLLLEDICVPSASSANSLSFKNITIPTISYPPPINGDFLWKIISNMSLNYLSLKDIKALRTILETHDFF
GAFDIKQKDKTNMILKGIESISFTTAELIDKGLPIRGMNISLVIEPSNFSCIGEAYLFCCVLNEFFSLYG
NINSFHRLTVNMKNEYLIEWVPRMGSLTLI
 
Nucleotide Sequence: 1773 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1739029-1740801 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGGCATTTAACGATTATTATAAAGAAGAATTAATTACACTTAGAAATGACGGAGCAGAGTTTTCTAAAA
AGAATCCTGGATTATCAACTTATCTTTCAAAAGAGGGTCAAGATCCTGATGTAGAAAGGTTGTTAGAGGG
GTTTTCTTTTTTAACAGGAAGATTAAAACAAAATTTAAATGAAGAATTGCCTGAAGTTGCACATACCTTA
GTTCAGCTACTTTGGCCAAATTATGTAAAGCCTATACCTTCATATTCTATTATCCAATATGATTCAATAA
AAGATTCAACTGAAAATAGTCACATTAAAAAGCATACTGAAGTTTTAAGTAAAATTAATTCGAGCAAAAC
CCAATGTAAATTTAGAACTATTTATGATATTGATATCATGCCTTTTATGCTAAAAAATATTAATTATTTT
ATTCATGGTAAAAAAAGTACCTTAGAGTTAAATATGGATATGACAGCATCTGGAACACTAAAAAATTTAG
TTTTTAAAGATTTAAGAGTTTATTTAAGCGGTTCTAAGTTTATTGCACAAAATTTATATTTATTTTTAAC
AAAATTTATTGAAAGAATTGAAATATCGATAAATAATGTTGATAATAAATCTATTTACAATATCAATATA
GATAATAACTCAATTACCCCTGTTAGTTTTGATTTAAGAAATAATATGACACCTTATTCTTCAAATCTAT
TTGACGGATATATCCTATTACAAGAATATTTTTCTTACAAAGATAAATTTCTTTTTTTAGATTTTAAAAA
TTTATCTAAAATAGAGAGTATTCCACATGAAATACTTGAAAATAGTAAAAACTTTACAATAAAAATTGAA
TTTAGAGAATCACTGTCTCGATCAGAGATACCAGATAAAAGTAACTTCTCTTTATATTGCACTCCAATTA
TAAATTTATTTGAAACGGATTCTATACCTATTCGAAAAAATGAAGAAATAGAAGAATTTTTAGTTGTACC
TTCTGATTTAAATAAAGATGCATGTGAAGTTTTTTCTATACAAAATGTAAGAGGATGGATTAGTAATAAA
AAAACTTACCAAGACTACTTACCTTTTGAATCATTTGAACATATAGATGAAGAGAATGAATACTATTCAT
CAAGAGTAAAATTAACCTCTGATGGAAAAAGAACAAATACATATCTTCGTTTTTCAACAGCCAAAGGAAG
AGAAAACAATTTTTTAACTAGTAATTCTACAGTTTCTGTAAAAATTTTATGTACAAACTTAAATATACCA
TCAACTCTTTTGCTAGAAGATATTTGTGTTCCAAGTGCATCTTCAGCAAATAGTTTATCTTTTAAAAATA
TAACTATTCCAACAATAAGTTATCCCCCTCCAATAAATGGGGATTTTTTATGGAAAATTATTTCAAATAT
GTCATTAAATTATCTATCTTTAAAAGATATTAAAGCACTTAGAACAATACTTGAAACACACGATTTTTTT
GGTGCATTTGACATAAAACAAAAAGATAAGACAAATATGATTTTAAAAGGCATTGAGTCTATTTCTTTTA
CTACTGCTGAACTTATTGATAAAGGATTACCAATAAGAGGAATGAACATAAGTCTGGTAATTGAACCAAG
TAATTTTTCCTGCATAGGGGAAGCATATTTATTCTGTTGTGTATTAAATGAATTTTTTTCATTATATGGA
AATATAAATTCATTTCATAGATTAACAGTTAATATGAAAAATGAATATTTAATTGAGTGGGTACCTAGAA
TGGGTAGCTTAACATTAATTTAG
 Primer design