SecReT6
Protein ID: 296273276
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1746
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1740810..1741802 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDD5V1G6
KEGG IDant:Arnit_1746
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-58, Aligned region: 38..315
Protein Sequence: 330 a.a.     [Download]
>gi|296273276|ref|YP_003655907.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MRIDEINYNIKPSTFKYTLPQAIRICFGYLKMIYKNKNSDDLYNNHIVFKSNHSLSFQRSELSNIDFIET
KEKIYVEITLNFLGIFGSASPLPVHYSELVLESFDSDRILYDFLNLFNHNLQKFIYPIWEKHRYYVQYKK
GLKDRFSKYILSFLGLYGHLENSSSLNLEKLIPYMGILIMKHKSAGTLKSILRHYLSHDEIEIIQCIPAN
YNIPSFQYSSLGQKNISLGSNFLIGESILSKNIKFRILLKNVTSEDLIKFSIKGDKLTQISDLISFSLNE
PLEHEICLKIKKENKVKFLLSKKEDRYIGINTWLGISDYDEEIIMAQEGK
 
Nucleotide Sequence: 993 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1740810-1741802 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAGAATTGATGAAATTAACTATAATATAAAACCTTCGACTTTTAAATATACTTTACCACAGGCAATAA
GAATTTGTTTTGGATATTTAAAAATGATTTATAAAAATAAAAATTCTGATGATTTGTATAACAATCATAT
AGTTTTTAAATCAAACCACAGTTTATCTTTTCAAAGATCAGAATTATCAAATATTGATTTTATAGAAACA
AAAGAAAAAATATATGTGGAAATTACATTAAATTTTTTAGGAATATTTGGAAGTGCATCTCCTCTTCCTG
TACATTACAGTGAATTAGTACTAGAAAGTTTTGATTCAGATAGAATTTTATATGATTTTTTAAACTTATT
CAATCATAATTTACAAAAATTTATCTATCCTATTTGGGAAAAACATAGATATTATGTTCAATATAAAAAA
GGACTTAAAGATAGATTTTCGAAATATATTTTATCTTTTTTAGGACTATATGGGCACCTTGAAAACTCAT
CTTCATTAAACCTAGAAAAACTAATACCATACATGGGTATTCTAATAATGAAACATAAATCAGCAGGAAC
ATTAAAATCAATATTAAGACACTATTTATCTCATGATGAAATTGAGATTATTCAGTGTATTCCTGCAAAT
TATAATATACCTTCTTTTCAATACTCTTCTTTAGGACAAAAAAACATATCTTTAGGAAGTAACTTCCTAA
TAGGGGAATCAATATTAAGTAAAAATATTAAATTTAGAATACTTCTCAAAAATGTAACTTCTGAAGATCT
AATAAAATTTAGTATTAAAGGGGATAAGTTAACTCAAATAAGTGATTTAATATCTTTTTCTCTCAATGAA
CCTCTTGAACACGAAATTTGTTTGAAAATAAAAAAAGAAAATAAAGTTAAGTTTTTATTGAGTAAGAAAG
AAGATAGATATATAGGTATAAATACTTGGTTAGGGATATCTGACTATGACGAAGAAATAATAATGGCACA
AGAAGGAAAATAA
 Primer design