SecReT6
Protein ID: 296273277
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1747
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1741802..1744336 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD5V1G7
KEGG IDant:Arnit_1747
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-43, Aligned region: 208..286
AAA_2 [PF07724], Evalue: 2.80E-43, Aligned region: 578..744
AAA [PF00004], Evalue: 6.70E-21, Aligned region: 210..343
AAA [PF00004], Evalue: 6.70E-21, Aligned region: 583..709
AAA_5 [PF07728], Evalue: 7.80E-15, Aligned region: 210..288
AAA_5 [PF07728], Evalue: 7.80E-15, Aligned region: 582..702
ClpB_D2-small [PF10431], Evalue: 5.80E-12, Aligned region: 749..819
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 187..227
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 253..288
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 397..473
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 574..602
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 651..676
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 209..308
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 580..605
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 194..270
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 582..600
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 692..710
AAA_29 [PF13555], Evalue: 2.70E-05, Aligned region: 202..226
AAA_29 [PF13555], Evalue: 2.70E-05, Aligned region: 578..607
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 207..231
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 578..602
Sigma54_activat [PF00158], Evalue: 5.60E-05, Aligned region: 206..226
Sigma54_activat [PF00158], Evalue: 5.60E-05, Aligned region: 581..696
NACHT [PF05729], Evalue: 0.00015, Aligned region: 210..237
NACHT [PF05729], Evalue: 0.00015, Aligned region: 582..607
Zeta_toxin [PF06414], Evalue: 0.00017, Aligned region: 210..227
Zeta_toxin [PF06414], Evalue: 0.00017, Aligned region: 580..622
AAA_17 [PF13207], Evalue: 0.00021, Aligned region: 210..251
AAA_17 [PF13207], Evalue: 0.00021, Aligned region: 432..461
AAA_17 [PF13207], Evalue: 0.00021, Aligned region: 581..605
DUF258 [PF03193], Evalue: 0.00054, Aligned region: 187..228
DUF258 [PF03193], Evalue: 0.00054, Aligned region: 579..599
AAA_25 [PF13481], Evalue: 0.00055, Aligned region: 210..273
AAA_25 [PF13481], Evalue: 0.00055, Aligned region: 578..611
RNA_helicase [PF00910], Evalue: 0.0017, Aligned region: 211..233
RNA_helicase [PF00910], Evalue: 0.0017, Aligned region: 583..603
AAA_30 [PF13604], Evalue: 0.0028, Aligned region: 195..227
AAA_30 [PF13604], Evalue: 0.0028, Aligned region: 579..603
SRP54 [PF00448], Evalue: 0.0037, Aligned region: 210..233
SRP54 [PF00448], Evalue: 0.0037, Aligned region: 581..603
RuvB_N [PF05496], Evalue: 0.0043, Aligned region: 263..290
RuvB_N [PF05496], Evalue: 0.0043, Aligned region: 549..603
RuvB_N [PF05496], Evalue: 0.0043, Aligned region: 649..673
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 46..63
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 210..251
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 459..480
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 583..606
AAA_10 [PF12846], Evalue: 0.0086, Aligned region: 210..228
AAA_10 [PF12846], Evalue: 0.0086, Aligned region: 267..297
AAA_10 [PF12846], Evalue: 0.0086, Aligned region: 455..470
AAA_10 [PF12846], Evalue: 0.0086, Aligned region: 579..613
MobB [PF03205], Evalue: 0.0088, Aligned region: 211..235
MobB [PF03205], Evalue: 0.0088, Aligned region: 581..604
AAA_23 [PF13476], Evalue: 0.0098, Aligned region: 578..615
Protein Sequence: 844 a.a.     [Download]
>gi|296273277|ref|YP_003655908.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MKIELNEIINALDVQTKFYIESSAQRCIERSGNEILIEDILYTMLEKDNSLFNKLLEHYEIDIQEMYNLL
QMSTKITNTESTNPIFSTMLVQWLEEAFYTSKMSLEINEITESSLILSLFDNSVKYSTTSYFKLIKNINT
NELKELILGLNKKKRERKSSQRTETSELDKYTTNLTKLAKEGKIDPVLCRDDEIKQAIDILLRRRKNNPI
LVGEAGVGKTAVVEGLALKIINKEVPDYLYEAQILSLDLGALQAGASVKGEFERRLQAVIREIQSSTQNI
ILFIDEAHTLIGAGGNEGGGDAANLLKPALARGELKTIAATTWLEYRKYFEKDPALSRRFQKINLLEPSV
EQAITILRGLSKKYEDVHNVYIEDDALRSAAILSARYITGRQLPDKAIDVLDTACANVKISKTNIPHTLQ
KINTQIIEKQREIDFLKRDHENEIKDYQSDILKLQEDLKELEREREVITNLWNEQKLLLNKIYETKDKEE
LSLLNIKLNQLQKEYSYIYKNVTKEQVAEVIASWTGIPLGNMVQGQIKNIMKLEDNIKERIIGQNEAISY
LTTFLQISIAGLKKEDAPNGVFLLVGPSGVGKTETAKAIADLMYGGERFITTINMTEFQEKHTVSRLIGS
PPGYVGYGDGGQLTDPVRVKPYSVVLLDEIEKAHPDILNLFYQIFDKGVANDGEGRVIDFKNTTIIMTSN
LATEKITELCVSKPDLTMDALTKEIIPTLSSYLQPALLGRMNVIPYFNLKDESLFEIANLKLNVIKDQLM
KKNISLQVDDKLLKYIVTLSNTVDTGARNIDLIININIMPKLSKYILNCIVNDISIDKLSVSINLDNDIL
ISHD
 
Nucleotide Sequence: 2535 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1741802-1744336 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAAAATTGAATTAAATGAAATAATAAATGCACTAGATGTTCAAACAAAGTTTTATATAGAAAGTTCTG
CACAAAGATGTATAGAAAGAAGTGGAAATGAAATATTAATAGAAGATATTTTATATACGATGTTAGAAAA
AGATAACAGTCTTTTTAATAAATTATTAGAACACTATGAAATAGATATACAAGAAATGTACAATCTATTA
CAAATGAGTACAAAAATAACAAATACAGAAAGTACAAATCCTATCTTTTCTACTATGTTAGTACAATGGT
TAGAAGAGGCATTTTATACTTCTAAAATGTCATTAGAAATAAATGAAATAACAGAATCATCATTAATTTT
ATCTTTATTTGATAACTCTGTAAAATATTCAACTACTTCATATTTTAAACTTATAAAAAATATAAATACC
AATGAATTAAAAGAGTTAATTTTAGGATTAAATAAAAAGAAAAGAGAAAGAAAAAGCAGTCAAAGAACTG
AAACAAGTGAATTAGATAAATACACAACAAACTTAACTAAACTAGCAAAAGAGGGGAAAATTGACCCTGT
TTTATGTAGAGATGATGAGATAAAGCAAGCAATTGATATTTTGCTAAGAAGAAGAAAAAATAATCCTATT
TTAGTAGGAGAAGCAGGGGTTGGGAAAACTGCAGTAGTTGAAGGACTAGCTTTAAAAATTATAAATAAAG
AGGTTCCTGATTATTTATATGAAGCACAAATTTTATCTTTAGATTTAGGTGCCCTACAAGCAGGTGCAAG
TGTAAAAGGTGAATTTGAAAGAAGATTACAAGCTGTGATAAGAGAAATACAATCAAGTACTCAAAATATT
ATACTATTTATTGATGAAGCACATACACTTATAGGTGCAGGAGGAAATGAAGGAGGGGGAGATGCTGCTA
ATTTATTAAAACCTGCCCTTGCAAGAGGAGAGCTAAAAACAATTGCTGCAACAACTTGGCTTGAATACAG
AAAATATTTTGAGAAAGATCCAGCATTATCAAGAAGATTTCAAAAGATAAACCTTCTTGAACCAAGCGTA
GAACAAGCAATTACAATATTAAGAGGACTTTCAAAAAAATATGAAGATGTTCATAATGTCTATATAGAAG
ATGATGCCTTAAGATCAGCTGCAATTCTCTCTGCAAGATATATTACAGGAAGACAATTACCAGATAAAGC
AATCGATGTTTTAGATACTGCTTGTGCAAATGTAAAAATAAGTAAAACAAATATACCTCATACTTTGCAA
AAAATTAATACTCAAATTATAGAAAAACAAAGGGAAATTGATTTTCTAAAAAGAGATCACGAAAATGAAA
TAAAAGATTATCAATCAGATATTCTAAAACTTCAAGAAGATTTAAAAGAATTAGAAAGAGAGCGTGAAGT
TATAACAAATTTATGGAATGAACAAAAATTATTATTAAACAAAATATACGAAACAAAAGATAAAGAAGAG
TTAAGTCTTTTAAATATCAAATTAAATCAATTGCAAAAAGAGTATTCATATATTTATAAAAATGTTACAA
AAGAACAAGTAGCTGAAGTTATTGCTTCATGGACGGGAATACCTTTAGGAAATATGGTTCAAGGACAAAT
AAAAAATATTATGAAACTTGAAGATAATATTAAAGAGCGAATAATTGGACAAAATGAAGCAATATCTTAT
TTAACTACATTCCTACAAATATCAATAGCTGGGTTAAAAAAAGAAGATGCTCCAAATGGAGTATTTTTAT
TAGTTGGACCAAGTGGCGTTGGCAAAACTGAAACTGCAAAAGCAATCGCTGATTTAATGTATGGTGGAGA
GCGATTTATTACTACTATTAATATGACAGAATTTCAAGAAAAACATACTGTTTCTAGATTGATTGGTTCA
CCTCCTGGTTATGTTGGATATGGAGATGGTGGTCAATTAACAGATCCTGTTAGAGTTAAACCATATTCAG
TTGTATTATTAGATGAAATCGAAAAAGCACATCCTGATATTTTAAATCTTTTCTATCAAATATTTGATAA
GGGAGTAGCAAATGATGGAGAGGGTAGAGTAATAGATTTTAAAAATACAACTATTATCATGACTTCAAAC
TTAGCAACAGAAAAGATAACTGAGTTGTGTGTAAGTAAACCTGATTTGACCATGGATGCTTTAACAAAAG
AAATTATACCAACTCTTTCTTCTTATTTGCAACCTGCTTTATTAGGAAGAATGAATGTAATTCCATATTT
TAATTTAAAAGATGAATCTTTATTTGAAATTGCTAATTTAAAACTAAATGTAATAAAAGATCAATTAATG
AAAAAAAATATCTCACTACAAGTAGATGATAAACTTTTAAAATACATCGTTACATTAAGCAATACAGTAG
ATACAGGTGCAAGAAATATTGATTTAATTATTAATATCAATATTATGCCAAAACTATCAAAATATATTTT
AAATTGCATAGTTAATGATATATCTATTGATAAGTTAAGTGTGTCTATTAATTTAGACAATGACATATTA
ATATCTCATGATTAA
 Primer design