SecReT6
Protein ID: 296273279
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1749
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1744484..1745767 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDD5V1G9
KEGG IDant:Arnit_1749
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.20E-13, Aligned region: 28..95
Protein Sequence: 427 a.a.     [Download]
>gi|296273279|ref|YP_003655910.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MKLIFDIIKSGRDIPNKNNFHFDMNGGSIGRSSESDWQLPDRQNYISSEHILIKFIDESYFIQDESTNGT
YLKEPYRKLPKNKQIKINSNDIFIVGEYEIQARFIDNDYSTKDILQSNYSNLSSTKSMGTIIPDDFEIIE
DMNSSFIKEDSKIEINDTLFNLFDEDNKHSSEIIYDFEKEEILFENEEEDSVTRNPMQEHIIVPSFNKKE
EELKESEIEEIDLEETIQSKKSNKKDSNISSEDKSLKYLEEKLGIKLSSLSDIEQKRILHEIANIVTYSL
DGLKNSLKLVDKVKKDLNIEDSFSHQNVNNPVLLGQFALNTDNKISLSDAVKKSFKQLDNHNIALQMSSK
NLVNITLNKFNPKSLEHHFNKQGYINSILPKKAQMWDSYEKMFDKLTSDSNLGIDLISEDFTKEYNKIVY
TIKLTSI
 
Nucleotide Sequence: 1284 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1744484-1745767 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAAACTTATTTTTGACATAATAAAAAGCGGAAGAGATATCCCAAATAAAAACAACTTTCATTTTGATA
TGAATGGTGGAAGTATAGGTCGTTCAAGTGAATCTGATTGGCAATTACCAGATAGACAAAATTATATTTC
AAGCGAACACATTTTAATAAAATTTATTGATGAGTCTTACTTTATTCAAGATGAAAGTACAAATGGCACA
TATTTAAAAGAACCTTATAGAAAACTACCAAAAAATAAGCAAATAAAAATCAATTCTAATGATATTTTTA
TTGTAGGTGAATATGAAATTCAAGCTAGATTTATTGATAATGATTATTCAACAAAGGACATTTTACAATC
AAACTATAGTAACTTATCATCCACTAAATCTATGGGAACAATTATTCCTGATGATTTTGAAATAATTGAA
GATATGAATAGTTCATTTATTAAAGAGGATTCTAAAATAGAAATAAATGATACTCTTTTTAATCTATTTG
ATGAAGATAATAAACATAGCTCAGAGATAATTTATGATTTTGAAAAAGAAGAAATTTTATTTGAGAATGA
GGAAGAGGATAGTGTAACAAGAAATCCAATGCAAGAACATATTATCGTTCCATCTTTTAACAAAAAAGAA
GAAGAACTAAAAGAAAGTGAAATTGAAGAAATAGATCTTGAAGAGACTATTCAATCTAAAAAAAGCAATA
AGAAAGATTCTAATATTAGTTCAGAAGATAAAAGTTTAAAATATTTAGAAGAAAAACTAGGAATTAAGCT
CTCTTCTTTAAGTGATATTGAACAAAAAAGAATATTACACGAAATAGCTAATATTGTAACATATTCATTA
GATGGTTTAAAAAATTCATTAAAATTAGTTGATAAAGTAAAAAAAGATTTAAACATAGAAGATTCCTTTT
CACATCAAAACGTTAATAACCCCGTTTTATTAGGACAATTTGCACTAAATACAGATAATAAAATAAGTTT
ATCAGATGCTGTGAAAAAATCATTTAAACAACTTGATAATCATAATATAGCATTGCAGATGTCAAGTAAA
AACCTTGTAAATATTACACTAAATAAATTTAATCCAAAAAGTTTAGAGCATCATTTTAACAAGCAAGGTT
ATATAAATTCAATCTTGCCTAAAAAAGCTCAAATGTGGGATTCTTACGAAAAGATGTTCGATAAATTAAC
TAGTGATTCTAATCTTGGTATAGATTTAATTTCTGAAGATTTTACAAAAGAATACAACAAAATTGTTTAT
ACAATTAAATTAACATCAATTTAA
 Primer design