SecReT6
Protein ID: 296273280
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1750
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1745778..1746227 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDD5V1H0
KEGG IDant:Arnit_1750
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-28, Aligned region: 15..138
Protein Sequence: 149 a.a.     [Download]
>gi|296273280|ref|YP_003655911.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MNIKFSIFMLISFIILITGCASKPTHLELVIKSAKDLNPDIDTVSSPLMLTFYELESAEKFLKYDFWRIV
DDSGKNLEPELISQSKQIIIPSQEQTYNIVFDDKAKFLGIIAKFRNIDGNNWRQVINLEKDSYNFSEFEI
KKFTIKRVE
 
Nucleotide Sequence: 450 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1745778-1746227 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAATATTAAATTTAGTATATTTATGTTAATAAGTTTTATTATACTTATTACAGGCTGTGCTTCTAAAC
CTACTCATTTAGAGTTAGTAATAAAGTCTGCAAAAGATTTAAATCCCGATATTGATACTGTTTCTTCTCC
ACTTATGTTAACTTTTTACGAACTAGAAAGTGCTGAGAAGTTTTTAAAATATGATTTTTGGAGAATAGTA
GATGATTCTGGTAAAAATCTTGAACCTGAATTGATTTCACAATCAAAACAAATTATTATTCCTTCTCAAG
AACAAACATACAATATTGTTTTTGATGATAAAGCAAAATTTTTAGGAATTATTGCAAAGTTTAGAAATAT
TGATGGAAATAATTGGAGACAAGTAATCAATTTAGAAAAAGATTCTTACAATTTTTCCGAGTTTGAAATA
AAAAAATTTACCATAAAGAGAGTTGAATAA
 Primer design