SecReT6
Protein ID: 296273281
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1751
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1746227..1747558 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDD5V1H1
KEGG IDant:Arnit_1751
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-105, Aligned region: 17..440
Protein Sequence: 443 a.a.     [Download]
>gi|296273281|ref|YP_003655912.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MQNNVVWKEGLFIRPQHFQQSDRYYNNEIITRTLNARPNNWGFYNLEIDEHLLNTGKIVIKRASGIMPDG
TLFNIDPKVNSLILNIEKIDSGKNVYLALPIFIDRSDTVHFEDQKNLSTRLKAVNSSNIPNTNAGENSSC
DILTAELNFKLLLEEELNENYTSLLITKVGSVSTSNIVSLDTNFTPTFLHLDSASVLSSKIKEILSMISY
RIKKLSEKISDSSLQATELSNYLMLQLLNKAENKFHFLISQNKVHPDILFYELSNLVAELAIFMKKEKRI
INHITYLHYQQSESFDKLITELKDMLTLVLDENSISLPIEKRKFGIYISALKDKKIVQDSTFIFSVSTSM
PSNKIKEILVASLKLGTIETIKNLVNFHLIGFKIKPLSTPPKEIPYRVNLLYFKIELTQENRDELMKSAG
FAFHLGSEIPDISYSLWAIKNNN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1746227-1747558 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGCAAAATAATGTTGTATGGAAAGAGGGACTATTTATTAGACCCCAACATTTCCAACAAAGTGATAGAT
ATTATAATAATGAAATAATAACAAGAACCTTGAATGCAAGACCTAATAATTGGGGTTTTTATAATTTAGA
AATTGATGAACACTTACTAAATACAGGAAAGATTGTCATTAAAAGAGCATCAGGAATAATGCCAGATGGG
ACACTTTTTAATATAGATCCAAAAGTTAATAGTCTAATTTTAAATATTGAAAAAATAGATAGTGGGAAAA
ATGTTTACTTGGCTTTGCCAATATTTATAGATAGAAGTGATACTGTACATTTTGAAGATCAAAAAAACTT
ATCTACTAGATTAAAAGCTGTAAATAGTTCAAATATACCCAATACTAACGCAGGTGAAAATAGTAGCTGT
GATATTTTAACAGCAGAATTAAATTTCAAACTTTTATTAGAAGAGGAATTAAATGAAAACTATACATCAT
TATTAATTACAAAAGTAGGTTCTGTTTCAACAAGTAATATTGTTTCTTTAGATACAAATTTTACTCCTAC
ATTTTTGCATTTAGATTCTGCATCAGTTTTATCATCAAAAATAAAAGAAATTTTATCAATGATTTCATAT
AGAATTAAAAAATTATCTGAAAAAATTAGTGATTCCTCTTTGCAAGCAACAGAGCTTTCTAATTATTTGA
TGCTTCAACTATTAAATAAAGCCGAAAATAAATTTCATTTTTTAATTTCACAAAATAAAGTTCACCCTGA
TATTTTATTTTATGAATTAAGTAATTTAGTAGCTGAACTAGCCATTTTTATGAAAAAAGAAAAAAGAATC
ATCAATCATATTACTTATCTTCATTACCAACAAAGTGAATCTTTTGATAAATTAATTACAGAACTTAAAG
ATATGCTTACCTTAGTTCTTGATGAAAATAGTATTTCTTTACCTATAGAAAAAAGAAAATTTGGTATTTA
TATATCTGCTTTAAAAGACAAAAAAATCGTTCAAGATTCAACATTCATTTTTTCTGTTTCAACAAGTATG
CCTTCGAATAAAATCAAAGAAATATTAGTAGCAAGTCTTAAATTAGGGACAATTGAAACAATAAAAAATC
TTGTTAATTTTCATTTAATTGGATTTAAGATCAAGCCTCTTTCTACACCTCCTAAAGAGATTCCATATAG
AGTAAATTTACTTTATTTTAAAATTGAATTAACTCAAGAAAATAGAGATGAATTGATGAAATCTGCTGGT
TTTGCTTTCCATTTAGGTTCTGAAATTCCAGATATAAGTTATTCTCTATGGGCAATAAAAAACAATAATT
AA
 Primer design