SecReT6
Protein ID: 296273282
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1752
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1747576..1748442 [+]
Producttype IV / VI secretion system protein
NoteTssL
UniProt IDD5V1H2
KEGG IDant:Arnit_1752
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-49, Aligned region: 56..260
Protein Sequence: 288 a.a.     [Download]
>gi|296273282|ref|YP_003655913.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MNNKTILISNNQNRNFSNNLTSNQRKTINRDNINNYQSRFKRSKQSKFKNYEISFNPFITAAMPIFKLVF
EIKEDIEDASINDIREEFIDKVNTYTETASSLDIDENEILVIRYVLCSFVDEFMNSHFLSKDYNWSNNSL
LSIFHNETYGGENFFHLLNRFLKTPAKYIHILELLYSCLALGFEGKYRVISRGEVELNNIKDSLFKQIKI
VQGREPFPFYSKQIPAQESYKLFNKIPYSTLFFSVSLLLLIIYSGLTFSLSNQNNDFIDLINNKTTIEID
DLYTGDKK
 
Nucleotide Sequence: 867 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1747576-1748442 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAATAATAAAACAATATTAATATCAAATAATCAAAATAGAAATTTTTCTAATAATTTGACATCAAATC
AAAGAAAAACTATAAATAGGGATAATATAAATAATTATCAAAGTAGATTTAAAAGATCAAAACAATCAAA
ATTTAAAAATTATGAAATAAGTTTTAATCCATTTATCACAGCTGCTATGCCAATCTTCAAATTAGTTTTT
GAGATTAAAGAAGATATTGAAGATGCAAGTATAAATGATATAAGAGAAGAGTTTATAGACAAAGTAAATA
CTTATACAGAAACTGCTTCTTCTCTTGATATAGATGAAAATGAGATATTAGTAATACGTTATGTATTATG
TTCATTTGTTGATGAATTTATGAATTCACATTTTTTAAGCAAAGATTACAATTGGTCAAATAATAGTTTG
CTAAGTATATTTCATAATGAGACTTATGGAGGAGAAAATTTCTTTCATTTACTTAATAGATTTTTAAAAA
CTCCTGCAAAATATATCCATATCCTTGAGTTATTATATTCTTGTCTTGCTTTAGGTTTTGAAGGGAAATA
TAGAGTAATAAGTAGAGGAGAAGTTGAATTAAATAATATCAAAGATAGTTTATTTAAACAAATAAAAATC
GTACAAGGAAGAGAACCATTCCCTTTTTATAGCAAACAAATACCTGCACAAGAGAGTTATAAATTATTTA
ATAAAATTCCTTATTCAACACTATTTTTTAGTGTGTCATTATTGTTATTAATCATTTACTCAGGATTAAC
GTTTAGTTTATCTAATCAAAATAATGATTTTATAGATTTGATTAATAATAAAACAACAATAGAAATAGAT
GATTTATATACAGGAGATAAGAAATGA
 Primer design