SecReT6
Protein ID: 296273283
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1753
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1748439..1751906 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDD5V1H3
KEGG IDant:Arnit_1753
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.00E-57, Aligned region: 191..435
IcmF-related [PF06761], Evalue: 3.90E-43, Aligned region: 501..773
DUF1215 [PF06744], Evalue: 2.50E-21, Aligned region: 582..594
DUF1215 [PF06744], Evalue: 2.50E-21, Aligned region: 895..1007
Protein Sequence: 1155 a.a.     [Download]
>gi|296273283|ref|YP_003655914.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MKKPFYKNIIFWIIFVSFFISLLIIFLFPYLFDSFKELNFRLLLSFSLFFGTIIAILLYIVFKKEETQEI
LKERAEQKELENEYKKVISEKVKDLKTKFKDAVRIIKKSSLYKNRSKINYELPWYLVIGDKAEGKSTLLE
SSGLNFPLNVNFEKRIAIEETTTKAFQWYFSEKSVFVDIPGNYIELNENPEDKIIWKEFLKLFTKKRWRR
PINGIILTISVDRLLKNEKELEKYAKDLRDRFDELSVSFMSSIPIYLMITKLDKIDGFSEYFINLSENEK
DEILGVTFDENKKNIDSSISKSELESLLKKLNSSVLEKMHFEWEKENRSKIFLFTEYLSDLFDKTNLFVD
ICFSQTRYRKPLLLRGIYYTSTPCSGNHQQLVSIDNLEYSRDKKGLFIRKVLSDIIFPESETIKMDDNYR
KKVKKNQTIALIISFAFIALVSTFYINDFINQNNSLRKMEKTFEVYKVAKNKFLPSDKVDDILILLNNIE
RIRKYNDIQDKSFWNLLFYKSEERHNELTKIYYNDLLTFLLPRIATVMEQNISKDLNDFDSTWDNTKAYV
MLENKPHRDIKFLSKYMAEEWSKRYPYNTKVQSELNYHFTKLLNFGFKPYSLNEDILKTARARLTKLGSE
RLTYKELILKSKDMRLESFKFSSVMLNNINEFKRNDYEIPGFYTKNGFNILMKDGMSLTKNILLNNWVIG
KKTNLSPIEISKHYQKVLSLYFLDYKEYWLNALSNLAIPIKTNTSSLNAQLAVFSSSDSPVLSVLKALKE
NTNIYTPSEIIKMKSSKSNVSSQIINATVSSQIGKTIAKEALNDIENEVDNRSIESMRNFFKDYNTLINK
ENSPDAILGNSINKLNTIYQLMSSIYSSINPDFDAYKIINDRINGNTTSFTNDLNKLPLYVKNWYLQLLR
SNWDNILRYGKNYIEKRFKEDVYSFYKTNLINKYPIDRKSSTYVRLDDFSEFFKPKGILDSFYNDYISNL
VSINSQFNSYSPKNLDGSIMNFNKNFMIGLMKSLKIRNLFFTNSGILKIEGNIKPYVLASNLATMDFFYD
DDSIIYEHGPIKTTKIIWPPKSSNYIVKFDLFDLSNNSVVEHYLDNEWALFKIIDTFRISRNLNNSIILK
YSNKKFTGSYYLSGDLSNIFGTSNLLSEFNLSEKL
 
Nucleotide Sequence: 3468 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1748439-1751906 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAAAAAACCTTTTTACAAAAATATTATATTTTGGATAATATTTGTTTCATTTTTTATTTCTTTGTTAA
TTATATTTCTATTCCCTTATTTATTTGATTCTTTTAAAGAGTTAAATTTTAGATTATTACTCTCTTTTAG
TTTATTTTTTGGCACAATAATAGCAATATTACTTTATATTGTATTTAAAAAAGAAGAAACCCAAGAAATA
CTAAAAGAAAGAGCTGAACAAAAAGAGTTAGAAAATGAATACAAAAAAGTCATTTCAGAAAAAGTCAAAG
ATTTAAAAACAAAATTTAAAGATGCAGTAAGAATAATCAAAAAATCCTCTTTATATAAAAATAGAAGCAA
AATTAATTATGAATTACCTTGGTACCTTGTAATAGGAGATAAAGCTGAAGGGAAATCAACATTATTAGAA
TCTTCAGGATTAAACTTTCCTTTAAATGTAAACTTTGAAAAAAGAATAGCAATAGAAGAGACAACAACAA
AAGCTTTCCAATGGTACTTTTCTGAGAAATCTGTTTTTGTAGATATTCCAGGAAATTATATTGAACTAAA
TGAAAACCCAGAAGATAAAATTATTTGGAAAGAATTTTTAAAACTATTTACAAAAAAAAGATGGAGAAGA
CCAATCAATGGAATCATCTTAACAATTAGTGTTGATAGGCTATTAAAAAATGAAAAAGAGTTAGAAAAGT
ATGCAAAAGATTTAAGAGATAGATTTGATGAATTATCTGTATCATTCATGTCTAGTATTCCAATTTATTT
GATGATAACAAAGTTAGATAAGATAGATGGATTTAGTGAATATTTTATTAATTTATCAGAAAATGAAAAA
GATGAAATATTAGGTGTTACCTTTGATGAAAATAAAAAAAATATTGATTCAAGTATTTCAAAAAGTGAAC
TTGAAAGCCTACTAAAAAAATTAAATAGTTCAGTATTAGAAAAGATGCATTTTGAATGGGAAAAAGAGAA
TAGGTCTAAAATATTTTTATTTACAGAATATTTATCTGATTTATTTGATAAAACAAACCTTTTTGTTGAT
ATATGTTTTTCACAAACAAGATATAGAAAACCACTACTTTTAAGAGGTATTTATTACACAAGTACTCCTT
GTAGCGGTAATCACCAACAGTTAGTTTCAATTGATAATTTAGAATATTCAAGAGATAAAAAAGGGCTATT
CATAAGAAAAGTCTTAAGTGATATCATTTTCCCTGAATCAGAAACAATAAAGATGGATGATAATTATCGA
AAAAAAGTAAAAAAGAACCAAACTATTGCTTTAATTATTTCATTTGCATTTATAGCTCTTGTTAGTACTT
TTTATATTAATGATTTTATTAATCAAAATAATAGCTTAAGAAAAATGGAAAAGACCTTTGAAGTATACAA
AGTCGCCAAAAATAAGTTTTTGCCTTCAGATAAAGTTGATGATATTTTAATTTTATTGAATAATATAGAA
AGAATTAGGAAATATAATGATATTCAAGATAAAAGTTTTTGGAATCTATTATTTTATAAATCAGAAGAAA
GACATAATGAACTAACAAAAATTTATTACAATGACTTGTTAACTTTTTTATTACCAAGAATAGCTACAGT
TATGGAACAAAATATTTCAAAAGATTTAAATGATTTTGATTCGACTTGGGATAATACAAAAGCATATGTA
ATGCTTGAAAATAAACCACACAGAGATATCAAGTTTTTATCTAAATATATGGCAGAAGAGTGGAGTAAAA
GATACCCTTACAATACTAAAGTACAAAGTGAATTAAACTATCACTTCACAAAATTATTAAATTTTGGGTT
TAAGCCTTATTCACTAAATGAAGATATATTAAAAACAGCAAGAGCTAGACTTACAAAATTAGGATCTGAA
AGATTAACATATAAAGAATTAATATTAAAATCAAAAGATATGAGACTAGAATCTTTTAAATTCTCTTCAG
TTATGTTAAATAATATAAATGAGTTCAAAAGAAATGACTATGAAATACCTGGTTTTTATACAAAGAATGG
ATTTAATATTTTGATGAAAGATGGTATGTCTTTAACAAAAAATATATTATTAAATAATTGGGTTATAGGC
AAAAAAACAAACCTTAGTCCTATTGAGATTAGTAAACATTACCAAAAAGTTTTAAGTTTGTATTTCTTAG
ATTATAAAGAATACTGGCTAAATGCACTTAGTAATCTTGCTATTCCTATTAAGACGAATACATCAAGTTT
AAATGCCCAATTAGCTGTGTTTTCATCTTCAGACTCACCAGTATTATCTGTATTAAAAGCTTTAAAAGAA
AATACTAATATTTATACTCCAAGTGAAATTATAAAAATGAAATCGAGTAAAAGCAATGTTTCTAGCCAAA
TTATAAATGCAACTGTTAGTAGTCAAATTGGAAAAACTATTGCAAAAGAAGCATTAAATGATATTGAAAA
TGAGGTAGATAATAGAAGTATAGAAAGTATGAGAAACTTCTTTAAGGATTATAATACTTTAATAAATAAA
GAAAATTCACCTGATGCTATTTTAGGAAATTCAATTAATAAATTAAATACTATTTATCAATTGATGTCAT
CAATTTACAGTAGTATAAACCCAGATTTTGATGCTTATAAAATTATAAATGATAGAATAAATGGAAATAC
TACATCTTTTACAAATGACTTAAACAAACTACCTTTATATGTGAAAAATTGGTATTTACAATTACTTCGT
TCAAATTGGGATAATATTTTAAGATATGGTAAAAATTACATTGAAAAAAGATTTAAAGAAGATGTATACT
CTTTCTATAAAACTAACTTAATAAATAAATATCCAATAGATAGAAAAAGTTCTACTTATGTGAGATTAGA
TGATTTTAGTGAATTCTTTAAACCAAAAGGAATTCTTGATTCATTTTATAATGATTATATTTCAAATTTG
GTTTCTATTAATTCTCAATTCAATAGTTATTCTCCTAAAAACTTAGATGGTAGTATCATGAATTTTAATA
AAAATTTCATGATTGGGTTAATGAAATCACTTAAAATAAGAAATCTGTTTTTTACAAACTCTGGTATTCT
TAAAATAGAAGGTAATATCAAACCTTACGTTTTAGCTTCAAATTTAGCAACTATGGACTTCTTTTATGAT
GATGATTCTATTATTTATGAACATGGACCAATAAAAACTACTAAAATAATTTGGCCACCAAAATCATCAA
ATTATATTGTGAAGTTTGATTTATTTGATTTATCAAATAATTCTGTTGTTGAACACTATTTAGATAATGA
ATGGGCTTTATTTAAAATAATAGATACCTTTAGAATTTCAAGAAATCTAAATAATTCAATAATATTAAAA
TATTCAAATAAAAAATTTACAGGTTCATATTATTTAAGTGGAGATTTAAGTAATATATTTGGTACAAGTA
ATTTATTGTCTGAGTTTAACTTAAGTGAAAAACTATAA
 Primer design