SecReT6
Protein ID: 296273286
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1756
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1753507..1754031 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDD5V1H6
KEGG IDant:Arnit_1756
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-39, Aligned region: 6..155
Protein Sequence: 174 a.a.     [Download]
>gi|296273286|ref|YP_003655917.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MNNPIFISIEGSTQGLITEGTFTPESVGNSYQKGHENEALLKGFSHNIRIPRDPQSGQPSGQRVHEPVII
TKLIDKSSPLLYNALTKGETLTKVELKWYRTSYAGKPEHYLSIVLEDAVIVDMHTSLDTEENLTKSQVAP
LETVSLAYRKITWRHEIASTSGEDDWRIGVGLNA
 
Nucleotide Sequence: 525 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1753507-1754031 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGAACAACCCTATATTTATTTCGATTGAAGGTAGTACACAAGGTTTAATTACTGAAGGTACATTTACAC
CAGAGTCTGTTGGAAACTCTTATCAAAAAGGTCATGAAAATGAAGCTTTGTTAAAAGGTTTTTCTCATAA
TATTAGAATACCAAGAGATCCACAATCTGGTCAACCATCAGGACAAAGAGTACACGAACCAGTTATTATC
ACTAAATTGATTGATAAGTCTTCACCTCTTTTATATAACGCATTAACAAAAGGTGAAACACTTACAAAAG
TTGAGTTAAAATGGTACAGAACAAGCTATGCTGGTAAGCCTGAACATTATTTAAGTATTGTACTTGAAGA
TGCTGTAATTGTAGATATGCACACTTCTCTTGATACAGAAGAAAACCTAACTAAGAGCCAAGTTGCTCCT
TTAGAAACAGTTTCTTTAGCTTATAGAAAGATTACATGGAGACATGAAATTGCAAGTACTTCAGGTGAAG
ATGATTGGAGAATTGGAGTAGGATTAAACGCTTAA
 Primer design