SecReT6
Protein ID: 296273290
SecReT6 ID397
T6SS typei1
Gene symbol-
Locus tagArnit_1760
StrainArcobacter nitrofigilis DSM 7299
Repliconchromosome [GenBank: NC_014166] [Browse all T6SS(s) in this replicon]
Location [Strand]1760774..1763308 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDD5V1I0
KEGG IDant:Arnit_1760
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 4.10E-17, Aligned region: 435..510
Phage_GPD [PF05954], Evalue: 1.70E-16, Aligned region: 66..340
Protein Sequence: 844 a.a.     [Download]
>gi|296273290|ref|YP_003655921.1| unnamed protein product [Arcobacter nitrofigilis DSM 7299]
MSKEIIRNNVEEIEEGLKSGVNLKELRREVKQDINARIKLLNYKPNATVGIIDGSFNVYKLLGSSSVNTP
YSFTITFVSDDFINIEDIVDTDIELNIKDNVNPLIKKTIYGKIFKASEDSIVAKKHLYIIEVVSPIYYLS
LNNKYEIFHNKKTSDIIVEIINRYNQLLNLKIDIKLDLIKAPTKEYTTQYNQNDLEFIQMLCEKEGYSLI
LDYSSNDPYTITLCELNEHAIVNTYSSTCSFNHSKEFKSTNYVQDFYDKDKPSLQYKIQTGSSITSSVED
NESTRQLRTDIKREKFRDKLNVLDESYYKDLNRYSKIDSQREYVKSNIIKGTSEELNINDSLCITLEDEK
ANKHIDSIILEVKYEGFFPNALDEYKQNIDESKKHQLQYEVEFTAIPKDIIYKPPYKIKKPKINSIQTAI
VSNGNSNTKDYTNTIDVDEQGRIKVLFHFETNQITSCYLRLSNMFSGDGYGSQFLPRVNSEVIVSFINGD
PDLPIIIGTLHNGENKNPYNLPKEKTKSFIKTHSIPQYEDKIGYNEIAFEDKRGDENLSLRAQKDMNTLV
LNDEFKHIENNSKTIINNDKEETVEANSILTVNKDYTQNIKENQINTVEKEKLTTVKEDYEIHALKDLNT
IVKNDIKTIVENDVTTSIKNILLKYVEKDASDKYLESLFIQVANELGVNIKDSFHLDTTNALYEGSNEIT
LEAKTGISLRCGGNIATVDSSGIHFNTPNYVKNSGNDGVNGVEVQYTGDIINLRADDTNRVFLSEVIEDD
YILRADTSLKEGTSVEATCFILGEEEKILAQKSKTINVKNSQLEAVFDLDEIKNKNQLDINDIEKYKGKM
QWEA
 
Nucleotide Sequence: 2535 bp     [Download]
>gi|296271545|ref|NC_014166.1|:1760774-1763308 Arcobacter nitrofigilis DSM 7299 chromosome, complete genome
ATGTCAAAAGAGATAATAAGAAATAATGTAGAAGAGATAGAAGAGGGACTAAAGAGTGGGGTAAACTTAA
AAGAGCTTAGACGTGAAGTTAAACAAGATATAAATGCAAGAATAAAACTATTAAACTATAAACCAAATGC
TACAGTTGGCATTATAGATGGAAGTTTTAATGTTTATAAACTTTTAGGTTCTAGTAGTGTTAATACTCCT
TACTCTTTTACTATTACTTTTGTTAGTGATGATTTTATTAATATTGAAGATATTGTTGATACTGATATTG
AGTTAAATATTAAAGATAATGTTAATCCTTTAATTAAAAAAACAATATATGGTAAAATATTTAAAGCTAG
TGAAGATTCTATTGTTGCAAAGAAACATCTTTATATTATAGAAGTTGTATCTCCTATTTATTATCTTAGT
TTAAATAATAAATATGAGATATTTCACAATAAAAAAACATCTGATATTATTGTTGAGATAATAAATAGAT
ATAACCAATTATTAAATTTAAAAATAGATATTAAATTAGATTTAATTAAAGCTCCAACTAAAGAGTATAC
AACTCAATATAATCAAAATGATTTAGAGTTTATTCAAATGCTTTGTGAGAAGGAGGGTTATAGTTTAATT
CTTGATTATTCTTCTAATGATCCATATACTATAACTCTTTGTGAATTAAATGAACATGCTATTGTAAATA
CTTATTCTTCTACTTGTAGTTTTAATCATAGTAAAGAGTTTAAATCTACAAACTATGTACAAGACTTTTA
TGATAAAGATAAACCAAGTTTACAATATAAAATCCAAACAGGTTCTAGTATAACTTCTAGTGTTGAAGAC
AATGAAAGTACTAGACAGTTAAGAACTGATATAAAAAGAGAAAAGTTTAGAGATAAGTTAAATGTATTAG
ACGAGTCTTATTATAAAGACTTAAATAGATACAGTAAAATAGACTCTCAAAGGGAATATGTAAAATCAAA
TATTATAAAAGGAACTTCTGAGGAGTTAAATATAAATGACTCATTATGTATAACATTAGAAGATGAAAAA
GCAAATAAGCATATTGATTCTATTATCTTAGAAGTAAAATATGAAGGCTTCTTTCCAAATGCTTTAGATG
AGTATAAACAAAACATAGATGAGAGTAAAAAACATCAACTTCAATATGAAGTAGAATTTACAGCCATTCC
AAAAGATATAATATATAAACCACCATATAAAATAAAAAAGCCTAAAATAAACTCAATACAAACAGCAATA
GTATCTAATGGCAATTCTAATACAAAAGATTATACTAATACAATAGATGTGGATGAACAAGGTAGAATAA
AAGTATTGTTTCACTTTGAGACTAATCAAATAACTTCTTGTTATTTAAGATTATCAAATATGTTTAGTGG
TGATGGATATGGTTCTCAATTTCTTCCAAGAGTTAACTCTGAAGTAATAGTAAGCTTTATAAATGGTGAT
CCAGATTTACCTATTATAATAGGAACTTTGCATAATGGTGAAAATAAAAATCCATATAATCTTCCAAAAG
AGAAAACAAAATCTTTTATAAAAACCCATTCTATTCCACAATATGAAGACAAAATAGGGTACAACGAAAT
AGCCTTTGAAGATAAAAGAGGAGATGAGAATTTATCTTTAAGAGCACAAAAGGATATGAATACCCTTGTA
CTTAATGATGAGTTTAAACATATAGAGAATAATTCAAAGACTATTATTAATAATGACAAAGAAGAGACAG
TAGAAGCAAACTCTATTTTAACAGTAAATAAAGACTATACACAAAATATAAAAGAAAATCAGATAAATAC
TGTAGAAAAAGAAAAACTTACTACTGTTAAAGAAGATTATGAAATTCACGCACTTAAAGATTTGAACACT
ATTGTTAAGAATGACATTAAGACTATTGTGGAAAATGATGTAACAACTTCGATTAAAAATATACTTTTAA
AATATGTAGAAAAAGATGCAAGTGATAAATACCTAGAAAGTCTTTTTATTCAAGTAGCAAATGAACTAGG
AGTAAATATAAAAGATAGCTTCCATCTTGATACAACAAACGCCTTATATGAAGGTTCAAATGAGATAACC
TTAGAAGCAAAAACAGGAATAAGTCTAAGATGTGGAGGAAATATAGCCACTGTAGATAGTTCAGGAATAC
ATTTTAATACTCCTAATTATGTTAAGAATTCAGGGAATGATGGGGTTAATGGGGTGGAAGTACAATATAC
AGGAGATATAATAAATTTAAGAGCTGATGATACAAATAGAGTATTTCTTAGTGAAGTTATAGAAGATGAT
TATATTTTAAGAGCAGATACAAGTCTAAAAGAAGGAACAAGTGTTGAAGCAACTTGTTTTATATTAGGTG
AAGAAGAAAAAATTTTAGCACAAAAAAGTAAAACAATAAATGTTAAAAACTCACAACTTGAAGCTGTTTT
TGATTTGGATGAAATAAAAAATAAAAACCAATTAGATATCAATGATATAGAAAAGTACAAGGGAAAGATG
CAATGGGAAGCTTAG
 Primer design