SecReT6
Protein ID: 299770680
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12230
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2626123..2629944 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDD8JMK8
KEGG IDacd:AOLE_12230
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.70E-71, Aligned region: 188..450
IcmF-related [PF06761], Evalue: 3.90E-53, Aligned region: 462..486
IcmF-related [PF06761], Evalue: 3.90E-53, Aligned region: 496..837
DUF1215 [PF06744], Evalue: 1.40E-25, Aligned region: 774..797
DUF1215 [PF06744], Evalue: 1.40E-25, Aligned region: 968..1078
FHIPEP [PF00771], Evalue: 0.0051, Aligned region: 10..105
FHIPEP [PF00771], Evalue: 0.0051, Aligned region: 454..597
Protein Sequence: 1273 a.a.     [Download]
>gi|299770680|ref|YP_003732706.1| type VI secretion protein IcmF [Acinetobacter oleivorans DR1]
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPHHIFWALATAYALGLIVYGIYWLIQRRKHAAQGEE
LAEAIEKDNQAEYGKNKDKEELQLVSQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAI
YNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPV
NGLILIVSIAELISQSPENSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYN
QAWGATLPYEQSSSHNAVDLFEKHYTILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFI
GTLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLTQIAQSDLKDHSKITPNHGYFLNGLFS
DVILKDKDLVKQHVNTGRKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIGEVQADLNKVVQLERASGQ
QLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLTPTQQNIAQYLQR
VKNNEATLKANHTNVEIKQTAQSQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWL
DANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQIVDQTRQVLLSVVRGMPARDRVYNEIKMRA
AVRFPALTVSQIVGEANKNVVLGSYALPGVFTQKAWNDYVEKAIEEAADKPTDSKDWVLNSRQSDDLTFS
GSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKAGQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDN
PVVQAELAAPQKGFVAWFKRKVLNHDDKTANQVATNAQGAISQEYQMFYQLVRKRDDQQGKSLLDEYMTN
LALVRSKFNELKNAGEVGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQRLLQKLVVSPLTQA
FESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKENLDPFVI
RRGYTLTSKTWKDLGISLNPQFVMNFQRYVTPSNGMATGELNSQAPAVPATNQSNFQFYPIPNPQLLSYT
VDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGF
EMLWRSKTDPSLVVKMNFRLISSNSGSIGSSRGYAGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTENP
VSALAQPSAGVKP
 
Nucleotide Sequence: 3822 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2629944-2626123 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGCATACAATTTTAGGCTACTTGTGGCAGTACATCACGAATCCTAAAGCAATTATCGCCTTGTCATTGT
TCGTGGCATTGATGTCTTCATATACTTCAATTCCTCATCATATATTCTGGGCTTTAGCAACTGCCTATGC
TTTGGGTCTTATTGTTTATGGTATCTATTGGCTTATTCAACGAAGAAAGCATGCTGCTCAGGGTGAAGAG
CTAGCTGAAGCAATTGAAAAAGACAACCAAGCTGAATATGGCAAAAATAAAGATAAAGAAGAGCTTCAGC
TTGTTAGTCAACAAATGAAAGAATCAATTCAACTGATTCGTAAATCTAAGTTGGGTGATAAAAAAGGAAA
TGCTGCATTATATGAGCTTCCTTGGTATATGGTTATTGGTAACCCAGCCGCAGGTAAAAGTTCAGCTATT
TATAATTCTGGTTTAAAGTTTCCTTTCGAAGAAACGCATCAAAAAATGGTATCTGCTGGTTTAAGCGGTA
CTCGAAATTGTGATTGGTTTTTCTCTACAGAAGGTATTTTGCTCGATACAGCGGGCCGTTATTCTGTTTA
TAGCGAAGATCATTCTGAGTGGTTAGGTTTCTTAAATATTTTAAAAAAGAACCGTTCTAAAGCTCCGGTT
AATGGTTTGATTTTAATTGTTAGTATTGCTGAGCTAATTAGTCAAAGTCCTGAAAACTCGTTAAAGCTAG
CTAAAAATTTACGTGCTCGTATTCAAGATCTAACCGAACGTCTAGAAGTAGTTGTACCTGTTTATTTAGT
CTTTTCAAAGATGGATTTGATTGCAGGTTTTACCGAATTTTTTGAATTTTACGAAGCTCAAGAATATAAC
CAAGCTTGGGGAGCAACGCTTCCATATGAGCAGAGTTCTTCTCATAACGCGGTAGATTTGTTCGAAAAAC
ATTACACTATTCTTTATGATGGTCTAAAAGGGGTAAGTTCGACTCATTTAAGTCGCCGTCATTCGCAAAA
TATCTCACCAAGTGTAATGACCTTCCCATTAGAATTTAAAACATTAAAACCAGCTTTAAAAAGCTTTATC
GGTACACTTTTTGAAGATAATCCATATCAATTTCAACCTGTTTTCCGTGGGTTTTACTTCACCAGTGCTT
TACAGGAAGGTGTCATTGAAAGTCCAATGACAGAACAAATTGCACAAGAATTCCAGCTGACTCAAATTGC
TCAAAGTGATTTAAAAGATCATTCAAAAATTACGCCTAACCATGGTTATTTCTTAAATGGTCTATTTTCA
GATGTTATTTTAAAAGATAAAGATCTTGTTAAGCAGCATGTAAATACGGGTAGAAAACGTCAACGCTATA
TTGCATTTATTGGTGCTTTAGCGGGCGTTTCAATTATTCTTGGCGTATGGGTTTGGTCATATCGTAATAA
CCAACAATTAATTGGTGAAGTTCAAGCTGATTTAAATAAGGTTGTTCAACTAGAAAGAGCTTCTGGTCAG
CAATTGTCTACCCAATTAGAAGCTTTACTTATTCTTCAAAGACGTCTACAGCAGTTGGATGAGTTTGATG
AAAATAGACCGCTTAAGTTTAGTTTTGGTTTATATCAGGGCAATGAGCTTCGTGAAAAGCTAAAAGCCGA
ATATTTAAAAGGTGTTAAGCAAATTGTATTAACACCGACACAGCAAAACATTGCTCAATATTTGCAACGT
GTAAAAAATAATGAAGCAACATTAAAAGCGAATCATACGAATGTGGAGATCAAGCAAACTGCTCAGTCTC
AACAATATTTAGAACCTTCAGATACAAATCCTCAAGATGCTTATAATGCATTAAAAGCGTATTTAATGAT
GAGTAATCCACAATACATGGATGCAAGTCATTTGAGTGATCAGGTTACGCGTTTCTGGCGTTCTTGGTTA
GACGCAAATAAAGGTCAAATGCCACGTGCAGATATGATTCAGGAAGCTGAACAAATCTTGTCGTACGCAA
TGACTTTGGCAAATGATAAACAGTTCCCAATTTTAGATGCAGATTCGCAAATTGTTGATCAAACACGCCA
AGTATTACTCTCTGTTGTTCGAGGAATGCCGGCGCGTGATCGTGTTTATAACGAAATAAAAATGCGTGCA
GCAGTACGTTTCCCAGCATTGACGGTAAGTCAGATTGTGGGTGAAGCAAATAAAAATGTTGTATTAGGCA
GTTATGCGTTGCCTGGCGTATTCACCCAAAAGGCATGGAATGACTATGTAGAAAAAGCAATTGAAGAAGC
AGCAGATAAGCCAACAGATAGTAAAGATTGGGTGTTAAATAGCCGTCAATCTGATGATTTAACTTTCTCA
GGTAGTCCAGAGCAAATTAGAAAGCAACTGACAGCACTCTATAAGCAAGAATACATTGCGGAATGGAGAA
AATTCTTAAGTGGTATTCATTATGCTAAAGCTGGCCAATTTGCTCAGCAAGTAAAAAATATTGATGTTTT
AGGTGAGCCACAGAACTCTCCAATTAGAACATTAATTGAAAGAGTGGCAATTGAAACAAACTGGGATAAT
CCAGTTGTACAAGCTGAGTTGGCAGCTCCACAAAAAGGATTTGTTGCATGGTTTAAACGTAAGGTTTTAA
ATCATGATGATAAGACTGCCAATCAAGTGGCAACTAATGCTCAGGGCGCTATTTCTCAAGAATACCAAAT
GTTCTATCAGTTGGTTCGCAAACGCGATGATCAACAAGGTAAATCATTGCTTGATGAATATATGACAAAT
TTAGCCCTTGTTCGTAGCAAGTTTAATGAGCTTAAGAATGCAGGTGAAGTTGGGCCTAATGCGATGACAT
TAGTCAAGCAAACCCTGAATGAGCAAACTTCTGTATTTAACCAGACGCAAAAAATTGTAGATGAAAAAAT
GGCGGTTGGTTTTAGTGAAATTGATCAGCGATTACTACAAAAATTAGTAGTTAGCCCACTTACACAGGCT
TTCGAGAGTTTAATTACACCGACACAAGACGAAATTAATAAATTATGGGTCATGCAGGCGTATCAGCCAT
TTACAGCAAATCTTGCTAAGAAATATCCATTTAATTCATCAGCTTCTTTGCAGGCGACAAGTAGTGAAAT
TGGACAAATTTTGGGCGAAAACGGCAGCATTTCTCGTTTTGTAAAAGAAAATCTTGATCCATTTGTGATT
CGTCGTGGTTATACATTAACGTCTAAGACATGGAAGGATTTAGGAATTAGTTTAAATCCTCAATTCGTTA
TGAATTTCCAAAGATACGTTACTCCATCTAATGGTATGGCAACAGGTGAGTTGAATAGTCAAGCTCCTGC
TGTACCTGCAACTAATCAATCTAACTTCCAGTTCTACCCAATTCCAAATCCACAATTGCTTTCATATACC
GTGGATATTGATGGTCAGCGCATGACTTATGAGAATGGTGTGCAACAGTGGGTGAACTTCATTTGGCCAA
ATCAAGGCAGTATTCCAGGTGCTCGAATTACCGCTGTAGATTTACAAGGTCAAACGCATACGATTTTTGA
TGAGCCGGGTGAATATGGTATTAATCGCTTAATTGATAGTGCTCAGCGTAAAGAACAAAATGGCGGATTT
GAAATGCTTTGGCGTAGTAAAACCGACCCATCATTAGTTGTAAAAATGAATTTCCGTCTGATCAGCAGTA
ATTCAGGCAGTATTGGCTCAAGCCGTGGTTATGCAGGTATGCAACTAGTGGATAAAGTCACTGCCGACAA
AGCTGCTCGCGTGGTGTCTGCTCAGCAGGCGCCAGCTCAAGCAGCAGCTCCAGCAAAAACAGAAAATCCT
GTTTCAGCACTTGCTCAGCCTTCTGCGGGAGTTAAACCATGA
 Primer design