SecReT6
Protein ID: 300310093
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0758
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]833419..837294 [-]
Producthypothetical protein
NoteTssM
UniProt IDD8IZF7
KEGG IDhse:Hsero_0758
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.70E-72, Aligned region: 63..100
ImcF-related_N [PF14331], Evalue: 2.70E-72, Aligned region: 187..448
IcmF-related [PF06761], Evalue: 8.30E-53, Aligned region: 493..844
DUF1215 [PF06744], Evalue: 3.90E-26, Aligned region: 69..91
DUF1215 [PF06744], Evalue: 3.90E-26, Aligned region: 745..777
DUF1215 [PF06744], Evalue: 3.90E-26, Aligned region: 976..1091
O-antigen_lig [PF13425], Evalue: 0.0064, Aligned region: 7..54
O-antigen_lig [PF13425], Evalue: 0.0064, Aligned region: 435..522
Protein Sequence: 1291 a.a.     [Download]
>gi|300310093|ref|YP_003774185.1| hypothetical protein Hsero_0758 [Herbaspirillum seropedicae SmR1]
MQRLWHFLSDTRTLVIIGFAALAAFLFIGASTLELALTWAAVILAIALLCWLGYWLYRRWKVRRAAGKLG
EVLEQQATQSVAASSDGAQREEVAALRTRMLEAINTIKTSKLGQKSGSAALYELPWYMVIGNPAAGKSTA
IANSGLQFPFADKGGKIVHGVGGTRNCDWFFTTDGILLDTAGRYSVYEEDRNEWFSFLGLLKRYRKQAPI
NGIIIAVSIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVVFTKADLITGFNEFFLDTERSERD
RVWGATLAYDRKRSGQEVVSFFDERFDELYAGLKEMSLASMSVKRGENMAPGVLTFPLEFSSIKGVLRSF
VATLFEENPFQFKPVFRGFYFTSAVQEGATVSASSQRIADRFGLALEHKPQREIFSQHGFFLHNLFKQVI
FADKQLVAQYTSRTKIRMRYATFFAAIAILGVLLGGWSWSYMGNRQLLANVQADMDKAVKLQEKRLDLQS
RFEALEILQDRIEQLDRYRASRPISVGMGLYQGDLLERKLREEYFSGIKEIMLKPVASNIESYLMEVNAN
AARLEPMSRPPQSGGITPVADNGAQAASALRTYKDSSATSVEDAYNALKTYLMLADKSRAESSHLNDQIT
RFWRGWLETNRGTMPREQMIRSAERLISFSLEQINDPSWPTIDNKLTLVDQARENLRRVVRGMPARERVY
ADVKARAATRFASMTVARIVGDKDRELVMGSYAIPGTFTRDAWEKFVQEAFKEAANKELQSADWVLKTSA
KDDLTLEGSPEQIQKALVTQYKTEYAREWQKFLQGVSIVELRNLDDATNAMNRLGDPITSPMKKVINTVY
DETSWDNPSLVDAGLANAKSGFMGWFKETILRRSPAPAPTQFNADGTTAIPMGPVGREFSGVARLVVSKD
KNGSLLQTYLDNLSKLRTRLNTIKNQGDTGPGAKQLMQQTLEGNGSELSDSLKFVDEEMLPGLNDQQKTV
LRPLLVRPLVQGFNALVRPTEGEVNKIWRAQVYEPFQSNLAAKYPFSPNSKIEANSGEIGTVFGENGAIS
KFVTTAMGPLVVRRGDTLSPRKWADMGINLSPAITSNFASWISAPGGGGDANGGANSAQTVFQIQPQPAP
GALEYTIEIDGQQLRYRNTQAQWTNFIWPNPQGTPGARVTAQTYDGRTIEVASQPGRFGLERLINSAQRK
RKDNGVFELSWTNEGVTVVVNLKIISSAEVSGTANGPARGTASLRGLKLPETIAGGAPAPVLAPAPAGAA
GTAPMQPGQPMATDAAAPQSNNQPTITGVKQ
 
Nucleotide Sequence: 3876 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c837294-833419 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGCAACGACTCTGGCACTTCCTCAGCGATACCCGCACCCTGGTCATCATCGGCTTCGCCGCCCTGGCCG
CATTCCTCTTCATCGGCGCCAGCACCCTGGAGCTGGCCCTGACCTGGGCCGCCGTGATCCTGGCCATCGC
CCTGCTATGCTGGCTGGGATACTGGCTGTACCGGCGCTGGAAGGTGCGGCGCGCCGCCGGCAAGCTGGGC
GAAGTGCTGGAACAGCAAGCCACCCAGTCGGTGGCGGCCAGCAGCGACGGCGCCCAGCGCGAAGAAGTCG
CCGCGCTGCGCACCCGCATGCTGGAGGCGATCAACACCATCAAGACCTCCAAGCTGGGGCAGAAGTCCGG
TTCGGCCGCCCTCTACGAGCTGCCCTGGTACATGGTGATCGGCAACCCCGCTGCCGGCAAGAGCACCGCC
ATCGCCAATTCCGGATTGCAGTTCCCCTTCGCCGACAAGGGCGGCAAGATCGTCCACGGCGTGGGCGGCA
CCCGCAACTGCGACTGGTTCTTCACCACCGACGGCATCCTGCTCGATACCGCCGGCCGCTATTCGGTCTA
TGAAGAAGACCGCAACGAGTGGTTCAGCTTCCTGGGCCTGCTCAAGCGCTATCGCAAGCAAGCGCCGATC
AACGGCATCATCATCGCGGTCAGCATCGCCGAACTGACCGGCAACCGTCCCGAATTCGCCATCAACCTGG
CCAAGAACCTGCGCCAGCGCGTGCAGGAGCTGACTGAAAAGCTGGAAGTGTTCGCCCCGGTCTATGTGGT
CTTCACCAAGGCCGACCTGATCACCGGCTTCAATGAATTCTTCCTCGACACCGAACGCAGCGAGCGTGAC
CGCGTCTGGGGCGCTACCCTCGCCTACGACCGCAAGCGCAGCGGCCAGGAAGTGGTCAGCTTCTTCGATG
AACGTTTCGACGAGCTCTACGCCGGCCTCAAGGAGATGAGCCTGGCCAGCATGTCGGTCAAGCGCGGTGA
AAACATGGCCCCGGGCGTGCTGACCTTCCCGCTGGAGTTTTCCTCGATCAAGGGCGTGCTGCGCTCCTTC
GTGGCCACGCTGTTCGAAGAGAATCCCTTCCAGTTCAAGCCGGTCTTCCGCGGCTTCTATTTCACCAGCG
CCGTGCAGGAAGGCGCCACCGTGAGCGCCTCTTCGCAACGCATCGCCGACCGCTTCGGACTGGCGCTGGA
ACACAAGCCGCAACGCGAGATCTTTTCCCAGCACGGCTTCTTCCTGCACAACCTGTTCAAGCAGGTGATC
TTCGCCGACAAGCAGCTGGTGGCGCAGTACACCAGCCGCACCAAGATCCGCATGCGCTATGCCACCTTCT
TCGCCGCCATCGCCATCCTGGGCGTGCTGCTGGGTGGCTGGAGCTGGTCCTACATGGGCAATCGCCAGCT
GCTGGCCAATGTGCAGGCCGACATGGACAAGGCCGTCAAGCTGCAGGAAAAACGCCTGGACCTGCAATCG
CGCTTCGAGGCGCTGGAAATCCTGCAGGACCGCATCGAACAGCTGGACCGCTACCGCGCCAGCCGTCCCA
TCTCAGTGGGCATGGGTCTCTACCAGGGTGATCTGCTGGAACGCAAGCTGCGCGAGGAATACTTCTCCGG
CATCAAGGAAATCATGTTGAAGCCGGTGGCCAGCAACATCGAGAGCTACCTGATGGAAGTCAACGCCAAT
GCCGCGCGCCTGGAGCCGATGTCGCGTCCGCCGCAATCGGGCGGCATCACGCCAGTGGCCGACAATGGCG
CGCAAGCCGCCAGCGCGCTGCGCACCTACAAGGACAGCTCGGCCACCAGCGTCGAGGATGCCTATAACGC
CCTGAAGACCTATCTGATGCTGGCCGACAAGTCGCGCGCCGAATCGAGCCATCTGAACGACCAGATCACC
CGCTTCTGGCGCGGCTGGCTGGAAACCAACCGTGGCACCATGCCGCGCGAACAGATGATCCGCAGCGCCG
AGCGCCTCATCAGTTTCTCGCTGGAACAGATCAACGATCCTTCCTGGCCGACCATCGACAACAAGCTGAC
CCTGGTGGACCAGGCCCGCGAAAACCTGCGCCGCGTGGTGCGCGGCATGCCCGCGCGCGAACGCGTGTAC
GCCGACGTCAAGGCCCGCGCCGCCACCCGCTTTGCTTCCATGACGGTAGCGCGCATCGTCGGCGACAAGG
ACCGCGAACTGGTCATGGGCAGCTATGCCATCCCCGGCACCTTCACCCGCGACGCCTGGGAGAAATTCGT
CCAGGAAGCCTTCAAGGAAGCCGCCAACAAGGAACTGCAGAGCGCCGACTGGGTGCTCAAGACCTCAGCC
AAGGATGACCTGACGCTGGAAGGCAGCCCCGAGCAGATCCAGAAGGCCCTGGTGACGCAGTACAAGACCG
AATATGCGCGCGAATGGCAGAAATTCCTGCAGGGCGTGAGCATCGTCGAACTGCGCAACCTGGACGACGC
CACCAATGCCATGAACCGCCTGGGCGATCCCATCACCTCGCCGATGAAGAAGGTCATCAACACCGTCTAT
GACGAGACCTCCTGGGACAATCCCTCGCTGGTGGACGCCGGCCTGGCCAACGCCAAGAGCGGCTTCATGG
GCTGGTTCAAGGAAACCATCCTGCGCCGCTCCCCTGCCCCCGCGCCGACCCAGTTCAACGCCGATGGCAC
GACCGCCATCCCGATGGGTCCAGTCGGCCGCGAATTCAGCGGCGTGGCGCGCCTGGTGGTGAGCAAGGAC
AAGAACGGATCGCTGCTGCAGACTTATCTGGACAACCTGTCCAAGCTGCGCACCCGCCTCAACACCATCA
AGAACCAGGGCGATACCGGCCCCGGCGCCAAGCAGCTGATGCAGCAGACGCTGGAAGGCAACGGTTCCGA
ACTGTCCGATTCGCTCAAGTTCGTCGACGAGGAAATGCTGCCCGGCCTGAACGACCAGCAGAAGACCGTG
CTGCGTCCGCTGCTGGTGCGTCCGCTGGTGCAGGGCTTCAACGCCCTGGTGCGGCCGACCGAAGGCGAGG
TCAACAAGATCTGGCGCGCCCAGGTGTACGAACCCTTCCAGAGCAATCTGGCAGCCAAGTACCCGTTCTC
GCCCAATTCCAAAATCGAAGCCAACAGCGGCGAGATCGGCACCGTCTTCGGCGAGAATGGCGCCATCTCC
AAGTTCGTCACCACGGCCATGGGTCCGCTGGTGGTGCGCCGTGGCGATACGCTGTCGCCGCGCAAGTGGG
CGGACATGGGCATTAACCTGTCACCGGCCATTACGAGCAACTTCGCCAGCTGGATCAGCGCCCCGGGCGG
CGGCGGCGATGCCAATGGCGGCGCCAACAGCGCCCAGACCGTGTTCCAGATCCAGCCGCAGCCCGCGCCC
GGTGCCCTGGAGTACACCATCGAGATCGACGGCCAGCAACTGCGCTACCGCAATACCCAGGCGCAGTGGA
CCAACTTCATCTGGCCCAATCCGCAGGGTACGCCAGGGGCCCGCGTGACGGCCCAGACCTACGACGGCCG
CACCATCGAAGTGGCCAGCCAGCCCGGCCGCTTCGGCCTGGAGCGCCTGATCAACTCGGCCCAGCGCAAG
CGCAAGGACAACGGCGTCTTCGAGCTGTCCTGGACCAATGAGGGCGTCACCGTGGTGGTCAACCTGAAGA
TCATCAGCAGCGCCGAAGTCTCAGGCACCGCCAACGGCCCTGCCCGCGGCACCGCCAGCCTGCGCGGCCT
GAAGCTGCCGGAGACCATTGCTGGGGGAGCGCCTGCGCCCGTCCTCGCCCCTGCTCCTGCCGGCGCCGCT
GGCACTGCGCCGATGCAGCCGGGGCAGCCGATGGCGACCGACGCTGCAGCCCCCCAGTCCAACAATCAAC
CAACCATTACAGGGGTCAAGCAATGA
 Primer design