SecReT6
Protein ID: 300313314
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4027
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4619344..4623144 [+]
Producthypothetical protein
NoteTssM
UniProt IDD8IST2
KEGG IDhse:Hsero_4027
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.80E-71, Aligned region: 84..108
ImcF-related_N [PF14331], Evalue: 8.80E-71, Aligned region: 187..448
IcmF-related [PF06761], Evalue: 4.90E-52, Aligned region: 64..80
IcmF-related [PF06761], Evalue: 4.90E-52, Aligned region: 493..844
DUF1215 [PF06744], Evalue: 6.10E-27, Aligned region: 978..1093
Protein Sequence: 1266 a.a.     [Download]
>gi|300313314|ref|YP_003777406.1| hypothetical protein Hsero_4027 [Herbaspirillum seropedicae SmR1]
MQRLWKILSDTRVLTLLGFMALAAVLFIGAEQLELAPIWPAVLFCALLLAWLALRRYQRWKAQRAATKLE
NVLEQQAAQPLPVDSEAARHDDVAALRQRMLEAINTIKTSKLGQKSGAAALYELPWYMVIGNPAAGKSTA
IANSGLQFPFADKGGKIVHGVGGTRNCDWFFTTDGILLDTAGRYSVYEEDRREWFSFLGLLKRYRKQAPI
NGIIIAVSIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVVFTKTDLITGFNEFFLDSERGERD
RVWGATLAYDRKHSGQEVSNFFDERFDELYAGLKEMSLANMAVKRGENLAPGVLTFPLEFSAFKGVLRSF
VTTLFEENPFQFKPVFRGFYFTSALQEGATLGASAQRIADRFGLTLEDQPQREVLSKQGFFLHNLFKQVI
FADKQLVAQYTSRNKIRMRYLTFFAALAMLGALLGGWSWSYMGNRQLVANVQADMDKAIKLQEKRLDLQS
RFEALEILQDRIEQLDRYRSHRPVSIDLGLYQGDLLERKLREEYFAGIKEIMLKPVASSIENYLIEVNAN
SSKLEPMSRPPQADSLATTGDNNIHAGNALRTYKDSSATNVEDAYNALKTYLMLSDKSRAEASHLNDQIT
RFWRGWLETNRGTMPREQMIRSAERLISFSLEQIDDPSWPTTENKLTLVDQTRENLRHVVRGMPARERVY
ADVKARAATRFASMTVARIVGDKDRELVMGSYAIPGTFTRNAWEKFVEDAFKEAANKELQSADWVLKTSS
KEDLTLEGSPEQIQKALVSQYKSEYAREWQKFLQGVSIVELHNLDDATNAMNRLGDPLTSPINKVISTVY
DETSWDNPSLIGSGLATASRGLSGWFKETVLRRSPAPPPAPPQLNTDGGAAIPMGPVAREFAGVARLVVS
KDKGNSLMRGYMENLSKLRTRLNTIKNQGDTGPGAKQLMQQTLDGSGSELSDALKFVDEEMLPGLNDQQK
TTLRPLLVRPLVQGFNALVHPTEGELNKIWRAQVYEPFQNNLATKYPFSPSSKIEANSGEINTVFGESGA
ISKFVTTAMGPLVVRRGDTLSPRKWADMGITLSPAITTSFADWISTHGSTGAGGGAGDAQTVFQIQPQPA
PGALEYTIEIDGQQLRYRNTQAQWVNFVWPNPQGSPGARVTAVTYDGRTVEVASQPGRFGLERLINTAQR
KRKDNGAFELSWTNEGVTVMVSLKIISSAEVSGNGSGTARGTAGLRGLKLPETIAGGGSALQAQPQTLTT
TTGATQ
 
Nucleotide Sequence: 3801 bp     [Download]
>gi|300309346|ref|NC_014323.1|:4619344-4623144 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGCAACGACTCTGGAAAATTCTCAGCGACACGCGCGTTCTCACTCTCCTAGGATTTATGGCGCTGGCCG
CCGTGCTTTTCATCGGCGCGGAGCAGCTGGAACTAGCCCCGATCTGGCCAGCAGTGCTGTTCTGCGCGCT
GTTGCTAGCGTGGCTGGCATTGCGGCGCTACCAGCGCTGGAAGGCACAGCGCGCGGCGACCAAGCTGGAA
AATGTACTAGAACAGCAAGCCGCCCAGCCGCTGCCTGTGGACAGCGAGGCAGCCCGCCACGACGACGTGG
CCGCCCTACGCCAGCGTATGCTGGAAGCCATCAACACCATCAAGACTTCCAAACTGGGACAGAAGTCGGG
CGCAGCAGCCTTGTACGAACTTCCCTGGTACATGGTCATCGGTAATCCGGCGGCTGGCAAAAGTACTGCC
ATCGCCAATTCCGGACTGCAGTTCCCCTTCGCCGACAAGGGCGGCAAGATCGTCCACGGCGTCGGCGGGA
CACGCAATTGCGACTGGTTCTTCACCACCGATGGCATCCTGCTCGATACCGCCGGGCGCTATTCGGTGTA
CGAGGAAGACCGCCGTGAATGGTTCAGCTTCCTTGGCTTGCTAAAGCGCTATCGCAAACAGGCGCCGATC
AACGGCATCATCATTGCCGTCAGCATTGCAGAACTGACCGGCAATCGTCCGGAATTCGCCATCAATCTGG
CCAAGAACCTGCGCCAGCGTGTGCAAGAGCTGACTGAAAAGCTGGAAGTCTTTGCCCCGGTGTATGTGGT
CTTCACGAAGACCGACCTGATTACCGGCTTCAACGAATTCTTCCTCGATAGCGAACGTGGCGAACGCGAC
CGCGTCTGGGGTGCGACCCTGGCCTACGACCGCAAGCACAGCGGACAGGAAGTGAGCAACTTCTTCGACG
AGCGCTTCGATGAACTCTATGCCGGCCTCAAGGAGATGAGCCTGGCCAACATGGCCGTCAAGCGTGGCGA
GAATCTGGCGCCGGGCGTACTGACCTTCCCCTTGGAATTCTCGGCCTTCAAGGGCGTCCTGCGCTCGTTC
GTGACGACCTTGTTCGAAGAAAATCCCTTCCAGTTCAAACCGGTCTTTCGCGGCTTCTACTTCACCAGTG
CTCTTCAGGAAGGAGCTACCCTGGGCGCCTCGGCGCAGCGTATCGCTGATCGCTTCGGACTGACGCTGGA
AGATCAACCCCAACGCGAAGTCCTCTCAAAGCAAGGCTTCTTCCTGCATAACCTGTTCAAGCAAGTGATC
TTCGCCGACAAGCAATTGGTGGCGCAGTACACCAGTCGCAACAAGATCCGCATGCGCTATCTCACTTTCT
TCGCCGCATTGGCCATGCTGGGCGCGCTACTGGGCGGCTGGAGCTGGTCTTACATGGGCAATCGACAGTT
GGTGGCCAATGTGCAGGCCGACATGGACAAGGCCATCAAGCTGCAAGAAAAACGTCTGGATCTGCAATCA
CGCTTCGAGGCACTGGAGATATTGCAAGATCGCATCGAACAGCTGGACCGCTATCGCTCTCATCGCCCAG
TCTCGATTGACCTCGGACTGTATCAGGGCGACCTTCTCGAACGCAAGCTACGAGAGGAATACTTTGCCGG
GATCAAGGAAATCATGCTGAAGCCGGTAGCCTCCAGCATCGAGAACTACCTGATCGAAGTCAATGCCAAT
TCCAGCAAGTTGGAACCGATGTCGAGGCCGCCTCAAGCCGATAGCCTCGCGACAACTGGCGACAACAACA
TCCATGCTGGCAACGCCCTGCGGACCTACAAGGACAGCTCGGCTACCAATGTGGAAGATGCTTACAATGC
GCTCAAGACCTACCTGATGCTATCGGACAAGTCGCGCGCCGAAGCCAGTCATCTGAACGACCAGATCACC
CGCTTCTGGCGTGGCTGGTTGGAAACCAACCGTGGCACCATGCCGCGCGAACAGATGATCCGTAGCGCCG
AGCGACTTATCAGCTTCTCGCTGGAGCAGATCGATGATCCGTCCTGGCCGACCACGGAAAACAAGCTGAC
GCTGGTCGACCAGACCCGAGAGAACTTGCGCCACGTGGTGCGTGGCATGCCGGCCCGTGAGCGCGTATAT
GCCGATGTCAAGGCACGTGCTGCGACCCGCTTTGCCTCCATGACCGTGGCGCGTATCGTCGGCGACAAGG
ACCGCGAACTGGTCATGGGCAGCTACGCCATCCCCGGCACCTTCACCCGCAACGCCTGGGAGAAGTTCGT
GGAGGACGCTTTCAAGGAAGCCGCCAACAAGGAACTGCAGAGCGCCGACTGGGTGCTCAAGACATCCTCC
AAGGAGGACCTGACGCTGGAAGGCAGTCCGGAGCAGATCCAGAAAGCCCTGGTCTCGCAGTACAAGAGCG
AATACGCCCGCGAGTGGCAGAAATTCCTTCAAGGCGTGAGTATCGTCGAACTACACAATCTCGACGACGC
TACCAATGCCATGAACCGCCTGGGCGACCCGCTGACCTCTCCGATCAACAAGGTCATCAGCACGGTGTAC
GATGAGACCTCGTGGGACAACCCTTCGCTCATCGGCTCCGGGCTGGCCACCGCCAGCAGAGGGCTCAGCG
GGTGGTTCAAGGAGACTGTCTTGCGTCGCTCCCCGGCCCCGCCACCTGCTCCGCCACAGCTCAATACCGA
TGGCGGCGCCGCCATCCCGATGGGACCGGTGGCCCGCGAGTTTGCAGGCGTGGCACGACTGGTGGTAAGC
AAGGACAAGGGCAATTCGCTCATGCGCGGCTACATGGAAAATCTCTCCAAGCTGCGTACCCGCCTTAACA
CCATCAAGAACCAGGGTGATACCGGTCCTGGCGCCAAACAATTGATGCAGCAGACGCTGGACGGCAGCGG
CTCGGAGCTGTCAGACGCACTCAAGTTCGTGGACGAGGAAATGCTACCCGGCCTCAACGATCAGCAGAAG
ACCACGTTACGGCCCTTGCTGGTACGTCCGCTGGTCCAGGGCTTCAATGCCTTGGTACACCCGACCGAAG
GTGAGCTCAACAAGATCTGGCGGGCTCAGGTTTACGAGCCATTCCAGAACAACTTGGCGACCAAGTATCC
ATTCTCGCCCAGCTCAAAGATCGAGGCTAACAGCGGCGAGATCAACACCGTCTTCGGTGAGAGCGGCGCC
ATCTCGAAGTTCGTGACCACAGCCATGGGACCACTGGTGGTGCGCCGGGGTGACACCCTGTCTCCGCGCA
AGTGGGCTGACATGGGCATCACCCTCTCGCCTGCCATCACCACCAGCTTCGCCGATTGGATCAGTACCCA
CGGCAGTACCGGCGCCGGTGGCGGCGCAGGGGATGCGCAGACGGTGTTCCAGATTCAACCCCAGCCAGCG
CCGGGCGCGCTGGAATACACCATCGAAATCGATGGCCAGCAACTGCGCTACCGCAACACTCAGGCCCAGT
GGGTCAACTTCGTCTGGCCCAACCCGCAGGGCTCACCAGGCGCGCGGGTGACTGCTGTGACCTATGACGG
GCGCACGGTGGAAGTGGCCAGCCAGCCGGGACGCTTTGGACTGGAGCGTCTGATAAACACTGCCCAGCGC
AAGCGCAAGGACAACGGAGCCTTTGAGCTGTCATGGACCAATGAAGGCGTTACGGTGATGGTGAGCCTCA
AGATCATCAGCAGCGCCGAAGTCTCCGGCAACGGCAGTGGTACCGCACGCGGTACAGCCGGCCTGCGCGG
ACTGAAGTTGCCCGAAACCATTGCAGGCGGCGGCTCGGCGCTGCAAGCACAACCACAGACGCTAACCACC
ACGACAGGGGCTACGCAATGA
 Primer design