SecReT6
Protein ID: 300693694
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0687
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]841560..845489 [-]
Productsecretion system protein
NoteTssM
UniProt IDD8N089
KEGG IDrsl:RPSI07_mp0687
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.80E-73, Aligned region: 80..102
ImcF-related_N [PF14331], Evalue: 1.80E-73, Aligned region: 183..441
IcmF-related [PF06761], Evalue: 6.50E-53, Aligned region: 488..860
DUF1215 [PF06744], Evalue: 2.80E-27, Aligned region: 996..1109
Protein Sequence: 1309 a.a.     [Download]
>gi|300693694|ref|YP_003749667.1| secretion system protein [Ralstonia solanacearum PSI07]
MQRFLNFLTNSRTLSILGVIVLTIFLLLMAQTFEIGLVWAGIALGALLALWLATALWKRWRARRASAKLE
GVLEQAADKSAAPDKREEVEALRVRLAEAVKTIKRSKLGQLSGDAALYELPWYIVIGNPAAGKSTAVLNS
GLQFPFADKGGAVIQGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRREWLGFLDLLKRYRPKAPINGIV
VTVSVSELTQNRPEFAINLAKNLRQRVQELTERLEVFAPVYVMFTKADLITGFTEFFGDSEKQERDRVWG
ATLPFEPDAKPDVAALFDQRFDELCDGLKEISVAQISLHQKNKLSPGLLSFPLEFASIKPALRAFLMTLF
DENPFQYKPVFRGFYFTSALQEGATNSASAERIARRFGLSTDGAARSREVFSKNGFFLRDLFSKVIFSDR
QTVRQFASPAKTRLRIATFFGLVLALGLLLGGWTWSYMGNRTLTANVQADLDKIVKLQQNRVDLQARLEA
LDILQDRIEQLERFRGEHPLALSLGLYQGDALQHKLLDEYYNGLRQVMLKPVGGALETFLADVNAHPDQL
APMVRPPETGAVIATSVTSATATIAASGAAANAPASPAATATASAGKRFTDASPTNVEDGYNALKTYLML
SDKRHVEVAHLTDQITRFWRGWLEDNRGNMPREQMIRSAERNLSFFLARVNDDNWPLLEGNLSLIDQTRE
NLRRVVRGMPARERAYAEIKARASTRYAPMTVARIVGETGSNVIAGSYAVPGTFTKEAWQGYVQPAIREA
ASKELQTKDWVLNVAARDDLTLEGSPEQIQKTLVTMYKTEYAREWQRFMQGVAVQDFSSFDQAVAGMNLL
GDPTNSPIRKVLDTAYDQTSWDNPSMFNAGLKQAKSGVLGWFKQLFARQTPSQINVNVDVGGNADAGTIP
MGPVGKEFAGLARVAVMRDDKSLLRGYMDALSKVRTRFNLIKNQGDPGPGARQLMQQTLDGNGSELADTL
KYVDEQMLTGMTDSERQTLRPLLVRPLLQSYAVVIRPASVEVNKVWNAQVYQPFSQTLAEKYPFAASAKI
EASAAEIGQIFGPEGAIAKFANTTIGPLSVRRGDMLAARTWGDLGLAFVPEFTSGFTRWIAPLTGGAAGG
AGGAAAAAPQTVFQILPVPSQGTTEYTIEIDGQQLRYRNTPPQWANFVWPNPQGVPGARVSATTFDGRTV
ELLNEPGRFGLERLIATANRKRRPDGAFDLTWARDGISVSVSLRIISSPQTAGASGSDSPQSQGLRGLRL
PTSIADVNASLNTSTPPAPAGSRPASAPAATTQAAARTTVTQEQGGTAQ
 
Nucleotide Sequence: 3930 bp     [Download]
>gi|300693042|ref|NC_014310.1|:c845489-841560 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGCAACGCTTCCTCAACTTCCTGACCAACTCACGCACGCTATCGATCCTGGGCGTGATCGTGTTGACGA
TCTTCCTGCTGCTGATGGCGCAGACCTTCGAGATTGGCCTGGTCTGGGCCGGCATCGCGCTCGGCGCGCT
GCTGGCGCTGTGGCTGGCGACCGCGCTCTGGAAACGCTGGCGCGCGCGCCGGGCGAGCGCCAAGCTCGAA
GGCGTGCTGGAGCAGGCGGCCGACAAGAGCGCCGCGCCGGACAAGCGCGAGGAAGTCGAAGCGCTGCGCG
TGCGCCTGGCCGAGGCGGTCAAGACCATCAAGCGCTCCAAGCTGGGGCAGCTGTCGGGCGACGCCGCGCT
CTATGAGCTGCCCTGGTACATCGTGATCGGCAACCCGGCGGCCGGCAAGAGCACGGCGGTGCTGAACTCG
GGCCTGCAGTTTCCGTTCGCCGACAAGGGCGGCGCGGTGATCCAGGGCATCGGCGGCACGCGCAACTGCG
ACTGGTTCTTCACCACCGAAGGCATCCTGCTCGACACCGCCGGCCGCTACTCGGTGCACGAGGAAGACCG
CCGCGAGTGGCTCGGCTTCCTCGACCTGCTCAAACGCTACCGTCCCAAGGCGCCGATCAACGGCATCGTC
GTGACGGTCAGCGTGTCGGAGCTCACGCAGAACCGCCCCGAGTTCGCCATCAACCTCGCCAAGAACCTGC
GCCAGCGCGTGCAGGAACTGACCGAGCGGCTGGAAGTGTTCGCCCCGGTCTACGTGATGTTCACCAAGGC
CGACCTCATCACCGGCTTCACGGAATTCTTCGGCGACAGCGAGAAGCAGGAGCGCGACCGCGTGTGGGGC
GCCACCCTGCCCTTCGAGCCGGATGCCAAGCCCGACGTGGCGGCACTGTTCGACCAGCGCTTCGATGAGC
TCTGCGATGGCCTGAAGGAGATCAGCGTGGCGCAGATCTCGCTGCACCAGAAGAACAAGCTGTCGCCGGG
GCTGCTGAGCTTCCCGCTGGAGTTCGCGTCGATCAAGCCGGCGCTGCGCGCCTTCCTGATGACGCTGTTC
GACGAAAACCCCTTCCAGTACAAGCCGGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGCG
CCACCAACAGCGCCTCGGCCGAGCGCATCGCGCGCCGCTTCGGCCTGTCCACCGACGGCGCCGCGCGCAG
CCGCGAGGTGTTCTCCAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCCAAGGTCATCTTCTCCGACCGC
CAGACGGTGCGGCAGTTCGCCAGCCCGGCCAAGACGCGCCTGCGCATCGCCACCTTCTTCGGGCTGGTGC
TGGCGCTGGGCCTGCTGCTGGGCGGCTGGACGTGGTCGTACATGGGCAACCGCACGCTGACCGCCAACGT
GCAGGCCGACCTGGACAAGATCGTCAAGCTGCAGCAGAACCGCGTGGACCTGCAGGCCCGGCTGGAGGCG
CTGGACATCCTGCAGGACCGCATCGAGCAGCTCGAGCGCTTCCGCGGCGAGCATCCGCTGGCGCTGTCGC
TGGGGCTCTACCAGGGCGACGCGCTGCAGCACAAGCTGCTCGACGAGTACTACAACGGCCTGCGCCAGGT
GATGCTCAAGCCGGTGGGCGGCGCGCTCGAGACCTTCCTGGCGGACGTCAACGCGCACCCCGACCAGCTC
GCGCCGATGGTGCGCCCGCCCGAGACCGGCGCGGTGATCGCCACCTCCGTCACCTCGGCGACGGCCACCA
TCGCGGCTTCGGGCGCCGCCGCCAATGCGCCGGCATCGCCCGCGGCCACGGCCACCGCGTCGGCCGGCAA
GCGCTTCACCGATGCCTCCCCCACCAACGTGGAAGACGGCTACAACGCGCTCAAGACCTACCTGATGCTG
TCGGACAAGCGCCACGTGGAAGTCGCGCACCTGACCGACCAGATCACGCGCTTCTGGCGCGGCTGGCTGG
AAGACAACCGGGGCAACATGCCGCGCGAGCAGATGATCCGCTCGGCCGAGCGCAACCTGTCGTTCTTCCT
GGCCCGCGTGAATGACGACAACTGGCCACTGCTGGAAGGCAACCTGTCGCTGATCGACCAGACCCGCGAA
AACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGCGAACGCGCCTACGCCGAGATCAAGGCCCGCGCCT
CGACCCGCTACGCGCCGATGACGGTCGCGCGCATCGTCGGCGAGACCGGCAGCAACGTGATCGCCGGCAG
CTACGCCGTGCCCGGCACCTTCACCAAGGAAGCGTGGCAGGGCTACGTGCAGCCCGCCATCCGCGAAGCC
GCCAGCAAGGAACTGCAGACCAAGGACTGGGTGCTCAACGTGGCCGCCCGCGACGACCTGACGCTGGAAG
GCAGCCCCGAGCAGATCCAGAAGACCCTGGTCACGATGTACAAGACCGAGTACGCCCGCGAGTGGCAGCG
CTTCATGCAGGGCGTGGCCGTCCAGGACTTCAGCAGCTTCGACCAGGCCGTGGCCGGCATGAACCTGCTG
GGCGACCCGACCAACTCGCCGATCCGCAAGGTGCTCGATACCGCCTACGACCAGACCTCGTGGGACAACC
CGTCTATGTTCAACGCCGGCCTGAAGCAGGCCAAGTCGGGCGTGCTGGGCTGGTTCAAGCAGCTCTTCGC
GCGGCAAACGCCGTCGCAGATCAACGTCAATGTGGACGTGGGCGGCAACGCCGATGCCGGCACCATCCCG
ATGGGGCCGGTGGGCAAGGAGTTCGCCGGGCTGGCGCGCGTGGCGGTGATGCGCGACGACAAGTCGCTGC
TGCGCGGCTACATGGACGCGCTGTCCAAGGTCCGCACCCGCTTCAACCTCATCAAGAACCAGGGTGACCC
CGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCTGGACGGCAACGGCTCCGAGCTGGCCGACACCCTC
AAGTACGTCGATGAGCAGATGCTGACGGGCATGACCGACAGCGAACGCCAGACGCTGCGCCCGCTGCTGG
TGCGTCCGCTGCTGCAGTCGTATGCGGTGGTGATCCGCCCGGCCAGCGTGGAAGTCAACAAGGTGTGGAA
CGCGCAGGTCTACCAGCCGTTCAGCCAGACGCTGGCCGAGAAGTATCCGTTTGCCGCCAGCGCCAAGATC
GAGGCCAGCGCGGCCGAGATCGGCCAGATCTTCGGGCCGGAGGGCGCCATCGCCAAGTTCGCCAACACGA
CCATCGGCCCGCTGTCGGTGCGCCGCGGCGACATGCTGGCCGCCCGCACCTGGGGCGACCTGGGCCTGGC
CTTCGTGCCCGAGTTCACCTCCGGCTTCACGCGCTGGATCGCCCCGCTGACGGGCGGTGCGGCGGGCGGC
GCCGGTGGCGCGGCTGCGGCGGCGCCGCAGACGGTGTTCCAGATCCTGCCGGTGCCATCGCAGGGCACCA
CCGAATACACCATCGAGATCGACGGCCAGCAACTGCGCTATCGCAACACGCCGCCGCAATGGGCCAACTT
CGTCTGGCCGAATCCGCAGGGCGTGCCGGGCGCGCGCGTGTCGGCCACGACCTTCGACGGACGCACCGTG
GAGCTGCTCAATGAACCGGGCCGCTTCGGCCTGGAGCGCCTGATCGCCACCGCGAACCGCAAGCGCCGCC
CCGATGGCGCGTTCGACCTGACCTGGGCGCGTGACGGCATCAGCGTGTCGGTCAGCCTGCGCATCATCAG
CAGCCCGCAGACGGCCGGTGCGTCGGGCTCCGATTCGCCGCAGAGCCAGGGCCTGCGCGGCCTGCGCCTG
CCGACCTCCATCGCGGATGTGAACGCCTCGCTGAACACCTCCACGCCGCCGGCGCCGGCAGGCAGCCGCC
CGGCCAGCGCGCCCGCCGCGACGACCCAGGCCGCCGCCCGGACCACCGTCACGCAGGAGCAAGGGGGGAC
GGCACAATGA
 Primer design