SecReT6
Protein ID: 300697373
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20213
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]924722..928651 [-]
Productputative secretion system protein (EvpO-like)
NoteTssM
UniProt IDD8P403
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-72, Aligned region: 82..102
ImcF-related_N [PF14331], Evalue: 2.20E-72, Aligned region: 183..441
IcmF-related [PF06761], Evalue: 5.90E-52, Aligned region: 488..860
DUF1215 [PF06744], Evalue: 1.30E-27, Aligned region: 996..1109
Protein Sequence: 1309 a.a.     [Download]
>gi|300697373|ref|YP_003748034.1| putative secretion system protein (EvpO-like) [Ralstonia solanacearum CFBP2957]
MQRFLNFLTHSRTLSILGVIVVTIFLLLMAQTFEIGLVWTGIALGVLLMLWLASALWKRWRARRASTRLE
GALEQSADKSTAPDKREEVEALRMRLAEAVKTIKHSKLGQLSGDAALYELPWYIVIGNPSAGKSTAVLNS
GLQFPFADKGGAVIQGIGGTRNCDWFFTTEGILLDTAGRYSVEDDARREWLGFLDLLKRYRPKAPINGIV
VTVSVSELTQNRPEFAINLAKNLRQRVQELTERLEVIAPVYVMFTKADLITGFTEFFGDSEKQERDRVWG
ASLPFEPDAKPDVAALFDQRFDELCDGLKEISVAQIALHQKNKLSPGLLSFPLEFASIKPALRSFLVTLF
DENPFQYKPVFRGFYFTSALQEGATNSASAERIARRFGLSTDGAARSREVFSKNGFFLRDLFSKIIFSDR
HTVRQFASPAKTRLRIATFFGLVLALGLLLGGWTWSYMGNRTLTANVQADLDKIVKLQQNRVDLQARLEA
LDILQDRIEQLERFRGEHPLALSLGLYQGDALQHKLLDEYYNGLRQVMLKPVGGALETFLADVNTHPDQL
APMVRPPETGAVIATSVTSATATVATSGAAANAPASPAATATAAAGKRFTDASPTNVEDGYNALKTYLML
SDKRHVEVAHLTDQITRFWRGWLEDNRGNMPREQMIRSAERNLSFFLARVNDDNWPLLEGNLSLIDQTRE
NLRRVVRGMPARERAYAEIKARASTRYAPMTVARIVGETGSNVIAGSYAVPGTFTKEAWQGYVQGAIREA
ASKELQTKDWVLNVAARDDLTLEGSPEQIQKTLVTMYKTEYAREWQRFMQGVAVQDFSGFDQAVAGMNLL
GDPTNSPIRKVLDTAYDQTSWDNPSMFNAGLKQAKSGMLGWFKQLFSRQTPSQINVNVDVGGNADAGAMP
MGPVGKEFAGLARVVVVRDDKSLLRGYMDALSKVRTRFNLIKNQGDPGPGARQLMQQTLDGNGSELADTL
KYVDEQMLTGMTDSERQTLRPLLVRPLLQSYAVVVRPASVEINKVWNAQVYQPFSQTLADKYPFAANAKI
EASAAEIGQIFGPEGAIAKFANTTIGPLSVRRGDMLAARTWGDLGLAFVPEFTSGFTRWIAPLTGGAAGG
AGGAAAAAPQTVFQILPVPSQGTTEYTIEIDGQQLRYRNTPPQWANFVWPNPQGAPGARVSATTFDGRTV
ELLNEPGRFGLERLIATANRKRRPDGAFDLTWARDGISVSVSLRIISSPQTAGASGSDSPQGQGLRGLRL
PTSIADANASQNASTPPAPAGSRPSSAPAATTQATTRAIVAQEQGGTAQ
 
Nucleotide Sequence: 3930 bp     [Download]
>gi|300696564|ref|NC_014309.1|:c928651-924722 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGCAACGTTTCCTCAACTTCCTGACCCACTCACGCACGCTCTCGATCCTGGGCGTGATCGTGGTGACGA
TCTTCCTGCTGCTGATGGCGCAGACCTTCGAGATTGGCCTGGTCTGGACCGGCATCGCGCTCGGCGTGCT
GCTGATGCTATGGCTGGCGAGCGCGCTCTGGAAGCGCTGGCGCGCGCGCCGCGCGAGCACCCGCCTGGAA
GGCGCGCTGGAGCAGTCGGCCGACAAGTCCACCGCCCCCGACAAGCGCGAGGAGGTCGAAGCCCTGCGCA
TGCGCCTGGCCGAGGCGGTCAAGACCATCAAGCACTCCAAGCTCGGGCAGTTGTCCGGCGACGCGGCCCT
CTACGAACTGCCCTGGTACATCGTGATCGGCAACCCGTCGGCCGGCAAGAGCACGGCGGTGCTGAACTCG
GGCCTGCAGTTTCCGTTCGCCGACAAGGGCGGCGCGGTGATCCAGGGCATCGGCGGCACGCGCAACTGCG
ACTGGTTCTTCACCACCGAAGGCATCCTGCTCGACACGGCCGGCCGCTACTCGGTGGAAGATGACGCCCG
CCGCGAATGGCTCGGCTTCCTGGACCTGCTCAAGCGCTATCGTCCCAAGGCGCCGATCAACGGCATCGTG
GTGACGGTGAGCGTGTCGGAGCTCACGCAGAACCGCCCCGAGTTCGCCATCAACCTCGCCAAGAACCTTC
GCCAGCGCGTGCAGGAGCTGACCGAGCGGCTGGAAGTGATCGCCCCGGTCTACGTGATGTTCACCAAGGC
CGACCTGATCACCGGCTTCACGGAATTCTTCGGCGACAGCGAGAAGCAGGAGCGCGACCGCGTGTGGGGC
GCCAGCCTGCCCTTCGAGCCGGATGCCAAGCCCGATGTGGCGGCGCTGTTCGACCAGCGCTTCGATGAGC
TGTGCGACGGCCTGAAGGAAATCAGCGTGGCGCAGATCGCGCTGCACCAGAAGAACAAGCTGTCGCCGGG
GCTGCTGAGCTTTCCGCTGGAGTTCGCGTCGATCAAGCCGGCGCTGCGCAGCTTCCTGGTGACGCTGTTC
GACGAGAACCCCTTCCAGTACAAGCCGGTGTTCCGCGGCTTCTATTTCACCAGCGCGCTGCAGGAAGGCG
CCACCAACAGCGCCTCGGCCGAGCGCATCGCGCGCCGCTTCGGCCTGTCCACGGACGGCGCCGCGCGCAG
CCGCGAGGTGTTCTCCAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCCAAGATCATCTTCTCCGACCGC
CACACCGTGCGGCAGTTTGCCAGCCCGGCCAAGACGCGGCTGCGCATCGCCACCTTCTTCGGGCTGGTGC
TGGCGCTGGGCCTGCTGCTGGGCGGCTGGACGTGGTCATACATGGGCAACCGCACGCTGACCGCCAACGT
GCAGGCCGATCTGGACAAGATCGTCAAGCTGCAGCAGAACCGCGTGGACCTGCAGGCCCGGCTGGAAGCG
CTGGACATCCTGCAGGACCGCATCGAACAGCTCGAACGCTTCCGCGGCGAGCATCCGCTGGCGCTTTCGC
TGGGGCTGTACCAGGGCGACGCGCTGCAGCACAAGCTGCTCGACGAGTACTACAATGGCCTGCGCCAGGT
GATGCTCAAGCCGGTGGGCGGCGCGCTCGAGACCTTCCTGGCGGACGTCAACACGCACCCCGACCAGCTC
GCGCCGATGGTGCGTCCGCCCGAGACCGGCGCGGTGATCGCCACCTCGGTCACCTCGGCGACGGCCACCG
TGGCGACTTCGGGCGCCGCCGCCAATGCGCCGGCATCGCCCGCGGCCACGGCCACCGCAGCGGCCGGCAA
GCGCTTCACCGATGCCTCGCCCACCAACGTGGAAGACGGCTACAACGCGCTCAAGACTTACCTGATGCTG
TCGGACAAGCGCCACGTGGAAGTCGCGCACCTGACCGACCAGATCACGCGCTTCTGGCGCGGCTGGCTGG
AAGACAACCGGGGCAACATGCCGCGCGAGCAGATGATCCGCTCGGCCGAGCGCAACCTGTCGTTCTTCCT
GGCCCGCGTCAACGATGACAACTGGCCGCTGCTGGAAGGCAACCTGTCGCTGATCGACCAGACCCGCGAG
AACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGCGAGCGTGCCTATGCCGAGATCAAGGCCCGCGCCT
CGACCCGCTACGCTCCGATGACGGTCGCGCGCATCGTCGGCGAGACCGGCTCCAACGTGATCGCCGGCAG
CTACGCCGTGCCCGGCACCTTCACCAAGGAAGCGTGGCAGGGCTACGTGCAGGGCGCCATCCGCGAAGCC
GCCAGCAAGGAGCTGCAGACCAAGGACTGGGTGCTCAATGTGGCCGCCCGCGACGACCTGACGCTGGAAG
GCAGCCCCGAGCAGATCCAGAAGACCCTGGTCACGATGTACAAGACCGAGTACGCCCGCGAATGGCAGCG
CTTCATGCAGGGCGTGGCCGTCCAGGACTTCAGCGGCTTCGACCAGGCCGTGGCCGGCATGAACCTGCTG
GGCGATCCGACCAACTCGCCGATCCGCAAGGTGCTCGACACCGCCTACGACCAGACCTCGTGGGACAACC
CGTCCATGTTCAACGCCGGCCTGAAGCAGGCCAAGTCGGGCATGCTGGGCTGGTTCAAGCAGCTCTTCTC
GCGGCAGACGCCGTCGCAGATCAACGTCAACGTGGACGTGGGCGGCAACGCCGATGCCGGCGCCATGCCG
ATGGGACCGGTGGGCAAGGAGTTCGCCGGGCTGGCGCGCGTGGTGGTGGTGCGCGACGACAAATCGCTGC
TGCGCGGCTACATGGATGCGCTGTCCAAGGTGCGCACCCGCTTCAACCTCATCAAGAACCAGGGCGACCC
CGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCTGGACGGCAACGGCTCCGAGCTGGCCGACACCCTC
AAGTACGTCGATGAGCAGATGCTGACCGGCATGACCGACAGCGAACGCCAGACGCTGCGCCCGCTGCTGG
TGCGTCCGCTGCTGCAGTCGTACGCGGTGGTGGTCCGTCCGGCCAGCGTGGAAATCAACAAGGTGTGGAA
CGCGCAGGTCTACCAGCCGTTCAGCCAGACGCTGGCCGACAAGTATCCGTTCGCCGCCAACGCCAAGATC
GAGGCCAGCGCGGCCGAGATCGGCCAGATCTTCGGGCCGGAAGGCGCCATCGCCAAGTTCGCCAACACGA
CCATCGGCCCGCTGTCGGTGCGCCGCGGCGACATGCTGGCCGCGCGCACCTGGGGCGACCTGGGCCTGGC
CTTCGTGCCCGAGTTCACCTCCGGCTTCACGCGCTGGATCGCCCCGCTGACGGGCGGTGCGGCGGGCGGC
GCCGGTGGCGCGGCCGCGGCGGCGCCGCAGACGGTGTTCCAGATCCTGCCGGTGCCGTCGCAGGGCACCA
CCGAATACACCATCGAGATCGACGGCCAGCAACTGCGCTACCGCAACACGCCGCCGCAATGGGCCAACTT
CGTCTGGCCGAATCCGCAGGGTGCGCCGGGTGCGCGCGTGTCGGCCACGACCTTCGACGGCCGCACGGTG
GAGCTGCTCAACGAGCCGGGGCGCTTCGGCCTGGAGCGCCTGATCGCCACCGCGAACCGCAAGCGTCGCC
CCGATGGCGCGTTCGACCTGACGTGGGCGCGTGACGGCATCAGCGTGTCGGTCAGCCTGCGCATCATCAG
CAGCCCGCAGACGGCCGGAGCGTCGGGCTCCGATTCGCCGCAGGGCCAGGGCCTGCGCGGCCTGCGCCTG
CCGACCTCCATCGCCGATGCGAACGCCTCGCAAAACGCCTCCACCCCGCCGGCGCCGGCGGGCAGCCGCC
CGTCCAGCGCGCCCGCCGCGACAACCCAGGCCACCACCCGGGCCATCGTCGCGCAAGAGCAGGGGGGGAC
GGCGCAATGA
 Primer design