SecReT6
Protein ID: 300715005
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04170
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]498853..502260 [+]
Producthypothetical protein
NoteTssM
UniProt IDD8MM64
KEGG IDebi:EbC_04170
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.70E-69, Aligned region: 410..728
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 851..971
Protein Sequence: 1135 a.a.     [Download]
>gi|300715005|ref|YP_003739808.1| unnamed protein product [Erwinia billingiae Eb661]
MKEHTIQPAARYGSWGYFLLIIGLAGISALLLYINQDALESAGATRHTVWAIWGAIFAVLLFGLIGSPLW
WRWQQRKNQAIYKPYTASKANKSTSANTAVVGQSLIRLKIYLRNRYHLFWRYKVRLLLVVGDDAAREALI
PGLREQQWLEGQRTVLIDGGSLSSEPDADKLGTLSRLRRSRPLDGIVWVLAHGQLMTPQMQDYGLRSLEN
ISQALRWQPPVWLWQLHGSDWSQQGREEQTVGVLFSARVRSEEVSEQLDSLAPQLREQGMAQIALHREHD
FLLRLGSELAQGESLQWQQRLTRWLTLQPPIPLRGLMFSLPSDARVSASHDHAVTLSNSWDGIVNASRHI
SGHRIGMPWQRVLAWALMAFIGLWGAGLLLSFALNRQQIVSMAEKAQMLVQTPTISDRQLTDLHALRNDA
GLLKYHHQDGTPWYQRFGLDHNTPLLEAMMPWYGVANNRLIRDPASAALQQRLNALAELPPNSPLRAERA
KPGYDQLKAWLMMARPDKADGAYYAQVMKTVQPTRDGISPGLWVSLAPDLWAFYITELPHQPQWKIIPDA
SLVSQSREVLLQQIGRRNAESTLYQNMLKSVRRNFADVSLEDMTSGTDARRLFTTNATVPGMFTRQAWEG
GVQQAIETAAKSRRDEIDWVLSDNRRSLSADLTPERLKERLTQRYFTDFAGSWLSFLNGLHLNPAANIAD
VTDQLTLMSDVRQSPLIALMNTLAWQGQAGQKSEALSDSLIKSAKELVGSSQKPVIDQGAAGPQGPLDET
FGPLLTLMGRNSAANALAGDDSPSLQTYLTRITRVRLRLQQVAGSSDPQEMMQTLAQTVFQGKSIDLTDT
RQYGSLIAASLGEEWSGFGQTMFVQPLTQAWETVLQPSAASLNDKWSRSVVALWRSAFDGRYPFAASNND
ASLPMLAEFLRKDSGRIERFLNSELSGVLHKEGSQWVPDRTNSQSLTFNPAFIKALNQLSQLSDVLFTDG
SQGISFELQARPTPGVVQTQLTIDGQQQKYFNQMAEWQTFRWPGDTFKPGTLLTWSTNSAGARLFGDYSG
TWGLIRWLEQGKRHQLDRSQWMMIFTAPDGSVLQWALRSQLGSGPLQLLQLRNFALPAEIFSVDAEMAAQ
AQPGSDELPAMEGES
 
Nucleotide Sequence: 3408 bp     [Download]
>gi|300714588|ref|NC_014306.1|:498853-502260 Erwinia billingiae Eb661 chromosome, complete genome
ATGAAGGAACATACAATACAGCCTGCCGCACGATATGGCTCTTGGGGATATTTTCTCCTGATTATTGGAT
TGGCAGGGATAAGTGCATTACTGCTGTATATCAATCAGGATGCATTGGAGAGTGCAGGAGCAACGCGTCA
TACGGTCTGGGCCATATGGGGAGCCATATTTGCCGTCTTGCTTTTTGGTCTGATTGGCTCACCGCTGTGG
TGGCGTTGGCAACAAAGAAAAAATCAGGCAATTTACAAACCATATACGGCGAGTAAGGCAAATAAATCAA
CATCTGCTAACACCGCAGTTGTTGGGCAAAGTTTGATCCGTCTTAAAATTTACCTCCGCAACCGCTATCA
CCTGTTCTGGCGCTACAAGGTACGCCTGTTGCTGGTCGTCGGCGATGATGCCGCGCGTGAAGCGCTGATC
CCCGGGCTGCGGGAGCAGCAGTGGTTGGAAGGGCAGCGCACCGTTCTGATTGACGGCGGTAGCCTCAGCT
CAGAACCGGACGCCGACAAGCTCGGCACGCTGAGCAGGCTGCGACGTAGCCGGCCGCTCGACGGTATTGT
CTGGGTACTGGCACACGGCCAGCTGATGACCCCGCAGATGCAGGATTACGGTCTGCGCAGCCTGGAGAAT
ATTTCGCAGGCGCTTCGCTGGCAGCCGCCGGTCTGGCTGTGGCAGCTGCATGGTAGCGACTGGTCCCAGC
AGGGGCGCGAAGAACAGACGGTTGGCGTCCTGTTTTCCGCGCGCGTGCGATCGGAAGAGGTCAGTGAGCA
GCTCGACAGTTTGGCCCCGCAGCTGCGTGAGCAGGGCATGGCGCAGATTGCGCTGCATCGCGAACATGAC
TTTCTGCTTCGGCTGGGCAGCGAGCTGGCGCAGGGGGAAAGCCTGCAGTGGCAGCAGCGCCTGACACGCT
GGCTGACCCTGCAACCGCCTATTCCGCTGCGCGGGCTGATGTTCAGCCTGCCGTCCGACGCGCGGGTTTC
GGCCAGCCATGACCATGCGGTGACTCTCTCCAACAGTTGGGACGGCATCGTGAATGCCAGCCGGCATATT
TCCGGGCATCGCATCGGCATGCCCTGGCAGCGGGTGCTGGCCTGGGCGCTGATGGCGTTTATTGGACTGT
GGGGCGCGGGTCTGCTGCTCTCATTTGCGCTCAACCGTCAGCAGATTGTCAGCATGGCGGAGAAGGCCCA
AATGCTGGTGCAGACTCCGACGATTTCCGATCGGCAGCTCACCGACCTGCACGCACTGCGCAACGATGCC
GGGCTACTTAAGTACCATCATCAGGACGGCACGCCCTGGTATCAACGCTTTGGCCTCGACCATAATACGC
CGCTGCTTGAAGCGATGATGCCGTGGTACGGCGTGGCGAATAACCGCCTGATACGCGACCCGGCCAGCGC
CGCGTTGCAGCAGCGGCTGAACGCGCTGGCAGAGCTGCCGCCAAACAGCCCGCTGCGCGCCGAACGCGCT
AAACCGGGATATGACCAGCTCAAGGCATGGCTGATGATGGCGCGCCCGGATAAGGCAGACGGCGCGTATT
ACGCGCAGGTGATGAAGACGGTGCAACCGACCCGGGACGGCATCTCGCCCGGCCTGTGGGTGAGCCTGGC
GCCGGACCTGTGGGCGTTTTACATCACGGAGCTGCCGCACCAGCCGCAGTGGAAAATTATCCCGGATGCC
TCGTTAGTCAGCCAAAGCCGCGAGGTTCTGCTGCAGCAGATTGGCCGACGTAATGCCGAAAGCACGCTGT
ATCAGAACATGCTGAAATCGGTGCGCCGCAACTTTGCCGACGTCTCCCTGGAGGATATGACCAGCGGCAC
CGATGCGCGCCGACTGTTCACCACCAATGCAACAGTGCCAGGCATGTTCACTCGCCAGGCATGGGAAGGC
GGCGTGCAGCAGGCGATTGAGACCGCGGCCAAATCACGGCGCGATGAGATTGACTGGGTGCTGAGCGACA
ATCGTCGTAGCCTGTCCGCTGACCTCACGCCGGAAAGGCTGAAAGAGCGCCTTACGCAGCGCTACTTCAC
CGACTTTGCCGGCAGCTGGCTCAGCTTCCTTAACGGCCTGCACCTGAACCCGGCTGCCAATATTGCTGAC
GTCACCGATCAGCTGACGCTGATGAGCGATGTACGTCAGTCGCCGTTGATTGCACTGATGAACACGCTGG
CATGGCAGGGGCAGGCCGGGCAGAAAAGCGAGGCGCTGTCAGACTCGTTAATCAAATCGGCGAAGGAGCT
GGTCGGCAGTAGCCAAAAGCCGGTCATTGACCAGGGCGCAGCCGGTCCGCAGGGCCCGCTTGACGAGACC
TTCGGTCCGCTGTTGACGCTGATGGGGAGGAATAGCGCCGCCAACGCGCTGGCCGGTGACGACAGTCCGA
GCCTGCAAACTTACCTGACGCGCATTACCCGCGTGCGCCTGCGACTGCAGCAGGTGGCGGGCAGCTCTGA
CCCGCAGGAGATGATGCAGACACTGGCACAAACCGTGTTCCAGGGCAAAAGCATTGACCTGACCGATACG
CGGCAATATGGCAGCCTGATTGCCGCCAGCCTCGGCGAGGAGTGGAGTGGCTTTGGACAGACGATGTTTG
TTCAGCCACTGACCCAGGCATGGGAAACGGTGTTGCAACCCTCCGCCGCCAGCCTTAATGATAAATGGTC
ACGCTCGGTGGTGGCGTTGTGGCGCAGCGCGTTTGATGGGCGCTACCCGTTTGCCGCCAGCAATAACGAC
GCCTCGCTGCCGATGCTGGCCGAGTTCCTGCGCAAGGATAGCGGGCGCATTGAGCGCTTTCTTAACAGCG
AGCTGAGCGGTGTGTTGCACAAAGAGGGCAGCCAGTGGGTGCCGGACCGCACTAACAGCCAGAGCCTGAC
CTTTAACCCGGCGTTTATTAAAGCGCTCAATCAGCTGAGCCAGCTGTCAGACGTGCTGTTCACCGACGGC
AGTCAGGGCATCAGTTTTGAGCTGCAGGCAAGGCCGACGCCGGGGGTGGTTCAGACTCAGCTCACTATCG
ATGGCCAGCAGCAGAAGTACTTCAATCAGATGGCTGAATGGCAGACCTTCCGCTGGCCGGGGGACACCTT
TAAGCCGGGTACCCTGCTGACATGGAGCACCAACAGTGCCGGCGCCAGACTGTTTGGCGACTATAGCGGC
ACATGGGGATTGATCCGCTGGCTGGAGCAGGGTAAGCGTCACCAGCTTGACCGCAGCCAGTGGATGATGA
TCTTTACTGCCCCTGACGGTAGCGTCCTGCAGTGGGCACTGCGCTCACAGCTGGGCAGCGGACCGTTACA
GCTGCTGCAGCTGCGTAACTTCGCGCTGCCGGCAGAGATTTTCAGCGTCGATGCCGAAATGGCCGCACAG
GCGCAGCCGGGAAGTGATGAGCTACCCGCCATGGAAGGAGAATCCTAA
 Primer design