SecReT6
Protein ID: 300715165
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05770
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]676756..677259 [+]
Productlipoprotein
NoteTssJ
UniProt IDD8MMQ1
KEGG IDebi:EbC_05770
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-26, Aligned region: 21..137
Protein Sequence: 167 a.a.     [Download]
>gi|300715165|ref|YP_003739968.1| unnamed protein product [Erwinia billingiae Eb661]
MKRHSFLRLSLQALFLIAVSLVAGCGSSTHSNPAHYNLVFQAHPQINDGAPLKIRVLLMKSDADFMSADF
YSLQNSAPALLGNNLITSEQFFLMPGQLNKVLQGQTTSEARYIGILAEYQSLDGKKWRISLPLPVPNDHS
YAFWQGSSDELKADIIADISGLRTVKP
 
Nucleotide Sequence: 504 bp     [Download]
>gi|300714588|ref|NC_014306.1|:676756-677259 Erwinia billingiae Eb661 chromosome, complete genome
ATGAAAAGACATTCATTTTTGCGCCTGAGTCTTCAGGCGCTTTTTCTGATAGCAGTCAGCCTTGTTGCTG
GCTGTGGTTCGTCTACACACAGCAATCCTGCTCACTACAACCTGGTTTTCCAGGCGCATCCGCAAATCAA
TGACGGCGCTCCGCTCAAGATCAGGGTGCTGTTAATGAAGTCGGATGCGGATTTCATGTCTGCCGACTTC
TATTCGTTGCAAAACAGCGCGCCCGCTCTGCTGGGCAACAACCTGATCACCAGCGAGCAGTTTTTCCTGA
TGCCAGGTCAGCTGAATAAAGTCCTCCAGGGGCAAACCACTTCAGAGGCGCGTTATATCGGGATCCTCGC
GGAGTATCAGTCTCTGGATGGCAAAAAATGGCGTATCTCATTGCCGCTGCCGGTACCCAATGACCATTCC
TACGCATTCTGGCAGGGGTCTTCTGACGAACTGAAAGCCGACATCATTGCTGACATCAGCGGTCTGCGCA
CCGTGAAACCGTGA
 Primer design