SecReT6
Protein ID: 300715166
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05780
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]677285..678628 [+]
Producthypothetical protein
NoteTssK
UniProt IDD8MMQ2
KEGG IDebi:EbC_05780
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.00E-145, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|300715166|ref|YP_003739969.1| unnamed protein product [Erwinia billingiae Eb661]
MNKAEKVVWTEGMFLRPHHFQQAESYQQSALRNWGLTQRPYLWGFLDYEIDEAMLRQGKVALSSASGLLP
DGTFFSFRDARNGPPPLAIPDNHVNELVVLALPARRNGREEVIFSESADSLARYVTFEQEVDDFNALSVG
GAAVQFGKLRLRLMLESELSAEWTAMATLRITEKRSDNQVRLDENFIPPMLNCVAHSKLYEYLSGMHGLL
QQRSQEIGQRLQQPGRFNSADMVDFMLLALVNHHVGHVSHLKDLPLLHPEQLFSTWLAFATELATYTPQR
FPDSELPTYDHDDLAFCFGKLMLMLRQGLSQVMEENAVQLMLTERSHGLNVATVTETSMVREFGFVLAVR
ANVPGEALQTHFPAQMKIAPVTKIRDLVQLQLPGMVLRPLPVAPPQIPWHTGYSYFELEKGSELWQEMEK
SGTFALHLAGDFPGLKMEFWAIRNHSV
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|300714588|ref|NC_014306.1|:677285-678628 Erwinia billingiae Eb661 chromosome, complete genome
ATGAATAAAGCAGAAAAAGTGGTCTGGACCGAGGGCATGTTCCTGCGTCCACACCATTTCCAGCAAGCAG
AGAGCTATCAACAAAGCGCGCTTCGTAACTGGGGACTGACCCAGCGGCCTTATCTCTGGGGCTTTTTAGA
TTATGAAATCGACGAAGCGATGTTGCGGCAGGGGAAAGTTGCCCTCAGCTCCGCCAGTGGATTGCTGCCT
GACGGCACCTTTTTCTCTTTCCGCGATGCGCGTAACGGGCCGCCGCCACTGGCTATCCCGGATAATCACG
TCAATGAGTTGGTGGTGCTGGCCCTGCCTGCCCGCCGTAATGGCCGTGAAGAGGTGATCTTCAGCGAGTC
GGCGGATTCGCTGGCGCGTTATGTCACCTTTGAACAGGAAGTGGATGACTTCAATGCGCTGTCGGTGGGC
GGCGCTGCCGTGCAGTTCGGCAAGCTTCGTCTGCGGTTGATGCTGGAAAGCGAGCTGTCAGCGGAATGGA
CGGCGATGGCCACGTTGCGCATCACCGAGAAGCGCAGTGATAACCAGGTTCGGCTGGATGAAAACTTCAT
TCCGCCGATGCTTAACTGCGTCGCGCACAGCAAGCTGTATGAGTATCTCAGCGGCATGCATGGGCTGTTA
CAGCAACGCAGCCAGGAAATCGGCCAGCGTCTGCAACAGCCTGGCCGCTTTAATTCGGCCGATATGGTCG
ACTTTATGCTGCTGGCGCTGGTTAACCACCACGTTGGCCACGTCAGCCATCTGAAAGATCTGCCGCTGCT
GCATCCTGAACAGCTGTTTTCCACCTGGCTGGCCTTTGCGACAGAACTGGCCACCTACACGCCTCAGCGC
TTCCCGGACAGCGAACTGCCGACCTATGACCATGACGATCTGGCCTTTTGCTTCGGCAAACTGATGCTGA
TGCTGCGTCAGGGGCTGTCGCAGGTGATGGAAGAGAACGCCGTTCAGCTGATGCTGACCGAACGATCGCA
CGGGCTGAACGTCGCCACCGTGACCGAAACCTCGATGGTCCGTGAGTTCGGCTTTGTGCTGGCGGTGCGC
GCCAATGTGCCCGGCGAGGCGCTGCAAACGCACTTCCCGGCGCAGATGAAGATTGCGCCGGTGACCAAAA
TTCGCGATCTGGTGCAGCTGCAGCTGCCGGGCATGGTGCTGCGGCCGTTGCCCGTCGCGCCGCCGCAAAT
TCCCTGGCACACCGGTTACAGCTACTTCGAGCTGGAGAAGGGCAGTGAGCTGTGGCAGGAGATGGAAAAA
TCCGGCACCTTCGCGCTCCATCTGGCAGGGGATTTCCCCGGTCTGAAGATGGAATTCTGGGCTATCCGTA
ACCACTCAGTCTGA
 Primer design