SecReT6
Protein ID: 300715167
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05790
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]678646..679884 [+]
ProductOmpA family protein
NoteTssL
UniProt IDD8MMQ3
KEGG IDebi:EbC_05790
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-67, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 1.30E-67, Aligned region: 348..389
OmpA [PF00691], Evalue: 3.80E-17, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|300715167|ref|YP_003739970.1| unnamed protein product [Erwinia billingiae Eb661]
MQQQQAFAQGDVFSGASNNNPLVAAANGLLNSIPQIRHSVSHADPAALRQRLIDEMRQFEMNCQRAGLAY
EVIIGARYCLCTALDEAAALTPWGSRGVWPGQGLLVTFHNETWGGEKFFQLLAKLSQNPREQIVLLELIN
YCLQLGFEGRYRVLDNGRSQLETIKQRLLQMIHSVRGGYAPPLSPHPEDHPVTRKLWRPVVPLWACTALV
GFLACLFYILLNWRLGDVTSPVLAAVYQTPLPEITIHNPAPPPPAALNLKAFLRPEIEQGLVAVKDEADQ
SVVTLKGDGLFTSASTSVRGRYEEVLDRIAQAMNNVNGRILVIGYSDNVPIRSARFASNYELSLARAQSV
QERLQQHLSQPQRVKAEGRGESNPLVPNTTAENRARNRRVDITLLVSPQNTRAEVNGLQQGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|300714588|ref|NC_014306.1|:678646-679884 Erwinia billingiae Eb661 chromosome, complete genome
ATGCAGCAACAACAGGCTTTTGCCCAGGGCGATGTGTTCTCGGGCGCCAGCAATAACAATCCTCTGGTGG
CCGCGGCGAACGGGTTATTAAATTCGATTCCGCAAATCCGCCATTCGGTCAGCCATGCCGATCCGGCCGC
GTTACGCCAGCGTTTGATCGACGAAATGCGCCAGTTCGAGATGAACTGCCAGCGGGCCGGACTGGCTTAT
GAAGTGATTATTGGCGCGCGCTACTGCTTATGTACCGCACTGGATGAAGCCGCTGCGCTCACGCCCTGGG
GCAGTCGCGGCGTCTGGCCCGGCCAGGGATTGCTGGTCACCTTCCACAATGAAACCTGGGGCGGCGAGAA
GTTCTTCCAGCTGCTGGCCAAACTTTCACAGAATCCGCGTGAACAAATCGTTCTGCTGGAGCTGATCAAC
TACTGTCTGCAACTGGGCTTTGAAGGGCGCTATCGCGTGCTGGATAACGGCCGTTCCCAGCTGGAAACCA
TCAAACAGCGCCTGCTGCAGATGATCCACTCCGTGCGCGGTGGCTATGCGCCGCCGCTTTCACCGCATCC
TGAAGATCATCCGGTCACGCGCAAATTGTGGCGGCCGGTGGTGCCTTTGTGGGCCTGCACGGCGCTGGTC
GGCTTCCTCGCCTGCCTGTTCTATATCCTGCTGAACTGGCGGCTGGGCGATGTCACCTCGCCGGTGCTGG
CTGCGGTCTACCAAACGCCGTTACCGGAAATCACCATTCATAACCCGGCACCGCCGCCGCCAGCGGCGTT
GAACCTTAAGGCGTTCCTGCGTCCTGAAATCGAACAGGGCCTGGTGGCGGTAAAAGATGAAGCCGACCAA
AGCGTGGTCACGCTAAAAGGCGACGGTCTGTTTACCTCGGCGTCCACCTCGGTTCGCGGGCGTTATGAAG
AGGTGCTGGATCGTATCGCTCAGGCGATGAACAACGTTAATGGCCGCATTCTGGTGATTGGCTACAGCGA
TAACGTGCCGATCCGCAGTGCGCGCTTCGCCTCTAACTATGAGCTTTCGCTGGCCAGGGCACAGTCCGTG
CAGGAGCGTCTGCAACAACATCTGTCACAGCCGCAACGCGTGAAAGCGGAAGGGCGCGGAGAGAGCAATC
CTCTGGTGCCGAATACCACCGCCGAAAATCGCGCCCGCAATCGCCGGGTGGACATCACGCTGTTAGTTTC
GCCGCAGAACACCCGCGCGGAAGTTAACGGTTTGCAGCAAGGAAATTAA
 Primer design